[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81507.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.213.1
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   24->162 3e4xA PDBj 2e-08 10.2 %
:RPS:SCOP  3->162 2ou6A1  a.213.1.2 * 2e-18 20.6 %
:HMM:SCOP  1->162 1rxqA_ a.213.1.1 * 2.9e-15 22.2 %
:RPS:PFM   38->162 PF07609 * DUF1572 8e-04 25.6 %
:HMM:PFM   27->161 PF04978 * DUF664 4.8e-12 24.8 133/150  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81507.1 GT:GENE AAS81507.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1131481..1131969) GB:FROM 1131481 GB:TO 1131969 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81507.1 GB:DB_XREF GI:46197093 LENGTH 162 SQ:AASEQ MPAPFLEPLEPGVSPAVSAWIKGLKEVALHLDKWAFDLPEEPFWRRPKEGANPIGGLVRHIAGSSLRLAHYALGVELPEWARKGREWELLGAPEPKEAVEARFREAWEVLLAAFRRVEEAALAEVVRVGHLGAEAPRAHVLHHLVEHAQHHAGQVIYARKLL GT:EXON 1|1-162:0| SEG 110->128|llaafrrveeaalaevvrv| RP:PDB:NREP 1 RP:PDB:REP 24->162|3e4xA|2e-08|10.2|127/149| RP:PFM:NREP 1 RP:PFM:REP 38->162|PF07609|8e-04|25.6|121/152|DUF1572| HM:PFM:NREP 1 HM:PFM:REP 27->161|PF04978|4.8e-12|24.8|133/150|DUF664| RP:SCP:NREP 1 RP:SCP:REP 3->162|2ou6A1|2e-18|20.6|160/183|a.213.1.2| HM:SCP:REP 1->162|1rxqA_|2.9e-15|22.2|162/174|a.213.1.1|1/1|DinB/YfiT-like putative metalloenzymes| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 89.5 SQ:SECSTR #################cHHHHHHHHHHHHHHHHHHTccGGGTTccccTTcccHHHHHHHHHHHHHHHHHHHHTcGGGGGcccccccccHHHHHcHHHHHHHHHHHHHHTcTTGGGcEEEEHHcEEcccHHHHcEEEHHHHHHHHHHHHHHHHHHHHHHHHT DISOP:02AL 1-2| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHccccHHHHHHHHccccHHHHHccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHcc //