[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81515.1
DDBJ      :             putative oxidoreductase-like protein
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  93/915 : Eukaryota  49/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:249 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   18->213 1y56B PDBj 1e-17 28.7 %
:RPS:PDB   18->216 1b3mA PDBj 4e-17 18.7 %
:RPS:SCOP  18->213 1ng3A1  c.3.1.2 * 9e-22 21.0 %
:HMM:SCOP  1->238 1el5A1 c.3.1.2 * 8.3e-43 31.5 %
:RPS:PFM   18->216 PF01266 * DAO 8e-11 33.3 %
:HMM:PFM   4->233 PF01266 * DAO 1.9e-54 32.8 229/358  
:BLT:SWISS 25->244 FXRD1_HUMAN 2e-16 33.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81515.1 GT:GENE AAS81515.1 GT:PRODUCT putative oxidoreductase-like protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1141158..1141907 GB:FROM 1141158 GB:TO 1141907 GB:DIRECTION + GB:PRODUCT putative oxidoreductase-like protein GB:PROTEIN_ID AAS81515.1 GB:DB_XREF GI:46197101 LENGTH 249 SQ:AASEQ MARVVVVGAGIVGAASAYRLAEKGLRVLVLEKEATYAQGSTGKSAAGVRVQFSEPLNVLLSYRSILEYREIPEAAYRPTGYLFLVPEAQAEAQEEALRVQKALGVPVEKLSLAEAQRKVPFREEGLAYATFGPMDGTIDPHGATAYYLREARRLGAEMRFSEPLLRAERREGVWRVETPKGLYEAPFLLLCTGAWTGEVGRTLGLEIPVQPVRRMVFATAPTPFPHAFPLTVDLGTGFYFRSEGSRLVK GT:EXON 1|1-249:0| BL:SWS:NREP 1 BL:SWS:REP 25->244|FXRD1_HUMAN|2e-16|33.6|220/486| SEG 2->17|arvvvvgagivgaasa| SEG 87->96|eaqaeaqeea| SEG 217->231|fataptpfphafplt| BL:PDB:NREP 1 BL:PDB:REP 18->213|1y56B|1e-17|28.7|195/374| RP:PDB:NREP 1 RP:PDB:REP 18->216|1b3mA|4e-17|18.7|198/385| RP:PFM:NREP 1 RP:PFM:REP 18->216|PF01266|8e-11|33.3|198/354|DAO| HM:PFM:NREP 1 HM:PFM:REP 4->233|PF01266|1.9e-54|32.8|229/358|DAO| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01266|IPR006076| RP:SCP:NREP 1 RP:SCP:REP 18->213|1ng3A1|9e-22|21.0|195/276|c.3.1.2| HM:SCP:REP 1->238|1el5A1|8.3e-43|31.5|232/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 249 OP:NHOMOORG 157 OP:PATTERN -----1-----------111111-------------------------------22222221------ -12-------1-------------1--------111--12-------1---------1----1---12--------------------------------------------------------------------11111---13-------------------------------------1--11--------------------------------1------------------------------------------------------------------------------------------------------------------------------------------1---1------1-----------------------------------------------23--2--1--2---11------2-1-11132---------------1-----------------------------11-----11--1-1111111111131111111112--11------------2122------------------------2---------------------1111-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-----------------------------------------------------------------------------------------111-1-1---1-- -----------------------1-1------------------------------------------------------------------------------------1111-12111-322222527N3-3141-2-312251121121-3-212--1-11----12---1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 229 STR:RPRED 92.0 SQ:SECSTR #################HHHHHTTccEEEEccccccccccccccccEEEEccccTTcTTHHHHHHHHHHHHcccccEEcccEEEEETTccHHHHHHHHHHHHHTcccEEEETHHHHHHcTTcccTTEEEEEETTcEEEEHHHHHHHHHHHHHHTTcEEEccccEEEEcccTTcEEEEETTEEEEEEEEEEccGGGHHHHGGGGTEEcccEEEEEEEccEEEEEEEEccHHHHcccccEEEEEcccE### PSIPRED cccEEEEcccHHHHHHHHHHHHcccEEEEEEcccccccccccccccEEccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEccHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHcccccccEEEEEEEccccEEcHHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEccccEEEEcEEEEcccccHHHHHHHccccccEEEEEEEEEEEccccccccccEEEEccccEEEEEccccccc //