[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81519.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:146 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81519.1 GT:GENE AAS81519.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1145785..1146225) GB:FROM 1145785 GB:TO 1146225 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81519.1 GB:DB_XREF GI:46197105 LENGTH 146 SQ:AASEQ MRKLLATAVLLLGLASAQFSVENLKPSFALVGGTQGFGGELSWHCLLFQPPVGEVRPALDLAYDVNGNLNGAFLFRYLYPVAEGLKAGVGLGVALPGFSFANLGLYFRADAEYDLAQFLNAPAFVGADLGLAGGTLAAQFKVGYRF GT:EXON 1|1-146:0| TM:NTM 3 TM:REGION 4->26| TM:REGION 29->51| TM:REGION 86->107| SEG 4->17|llatavlllglasa| SEG 81->97|vaeglkagvglgvalpg| SEG 126->138|gadlglaggtlaa| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cHHHHHHHHHHHHHHcccEEcccccccEEEEEccccccccEEEEEEEEEcccccccccEEEEEEccccccHHHHHHHHHHHHHHHHcccccEEEccccccccccEEEEEccccHHHHHHccccEEccccccccccEEEEEEEEEcc //