[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81520.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:131 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->123 2dstA PDBj 6e-68 98.4 %
:RPS:PDB   2->123 2dstA PDBj 1e-07 98.4 %
:RPS:SCOP  2->123 2dstA1  c.69.1.39 * 8e-08 98.4 %
:HMM:SCOP  1->86 1j1iA_ c.69.1.10 * 1.1e-05 32.6 %
:HMM:PFM   41->72 PF12146 * Hydrolase_4 8.7e-07 34.4 32/79  
:BLT:SWISS 3->93 DSBD_SODGM 4e-04 35.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81520.1 GT:GENE AAS81520.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1146222..1146617) GB:FROM 1146222 GB:TO 1146617 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81520.1 GB:DB_XREF GI:46197106 LENGTH 131 SQ:AASEQ MRRAGYLHLYGLNLVFDRVGKGPPVLLVAEEASRWPEALPEGYAFYLLDLPGYGRTEGPRMAPEELAHFVAGFVVMMNLGAPWVLLRGLGLALGPHLEALGLRALPAEGVEVAAVLSSKLSYGNIDLGGNL GT:EXON 1|1-131:0| BL:SWS:NREP 1 BL:SWS:REP 3->93|DSBD_SODGM|4e-04|35.2|91/590| TM:NTM 1 TM:REGION 68->90| BL:PDB:NREP 1 BL:PDB:REP 2->123|2dstA|6e-68|98.4|122/122| RP:PDB:NREP 1 RP:PDB:REP 2->123|2dstA|1e-07|98.4|122/122| HM:PFM:NREP 1 HM:PFM:REP 41->72|PF12146|8.7e-07|34.4|32/79|Hydrolase_4| RP:SCP:NREP 1 RP:SCP:REP 2->123|2dstA1|8e-08|98.4|122/122|c.69.1.39| HM:SCP:REP 1->86|1j1iA_|1.1e-05|32.6|86/0|c.69.1.10|1/1|alpha/beta-Hydrolases| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 123 STR:RPRED 93.9 SQ:SECSTR ccEEEEEEETTEEEEEEEEccccEEEEEcccGGGccccccTTcEEEEEccTTcTTcccccccHHHHHHHHHHHHHHTTccccEEEEcGGGGGGHHHHHHTTccEEEcccccHHHHHHHHHHcc######## DISOP:02AL 1-3, 130-131| PSIPRED cccccEEEEEHHHHHHHHccccccEEEEEccccccHHcccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHcccccccccHHHHHHHHHccccccEEccccc //