[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81521.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:179 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   104->164 3e3aB PDBj 3e-04 42.4 %
:RPS:PDB   62->165 2eepA PDBj 6e-11 14.4 %
:RPS:SCOP  1->165 1c4xA  c.69.1.10 * 7e-10 17.1 %
:HMM:SCOP  6->165 1q0rA_ c.69.1.28 * 1.4e-13 34.2 %
:HMM:PFM   106->166 PF08386 * Abhydrolase_4 8.5e-08 33.3 60/103  
:BLT:SWISS 108->165 BPHD_COMTE 4e-05 38.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81521.1 GT:GENE AAS81521.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1146614..1147153) GB:FROM 1146614 GB:TO 1147153 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81521.1 GB:DB_XREF GI:46197107 LENGTH 179 SQ:AASEQ MAFAEGALDALKVAFQEGARSLVLLSPVLFRDALLSARLGALRFGLERGGVEGFARVGRALFFGALSAGSEEVYEAWKEGLSEAGLWRWLGRLEALADERRWLRGTAARVLVVQGALDAFTPPLHGAKVADFAKGEALRFVVDEAGHLVPWEAQEEVRDLVADFLLGEGFRPLPGGLAL GT:EXON 1|1-179:0| BL:SWS:NREP 1 BL:SWS:REP 108->165|BPHD_COMTE|4e-05|38.6|57/286| BL:PDB:NREP 1 BL:PDB:REP 104->164|3e3aB|3e-04|42.4|59/275| RP:PDB:NREP 1 RP:PDB:REP 62->165|2eepA|6e-11|14.4|104/659| HM:PFM:NREP 1 HM:PFM:REP 106->166|PF08386|8.5e-08|33.3|60/103|Abhydrolase_4| RP:SCP:NREP 1 RP:SCP:REP 1->165|1c4xA|7e-10|17.1|164/281|c.69.1.10| HM:SCP:REP 6->165|1q0rA_|1.4e-13|34.2|158/297|c.69.1.28|1/1|alpha/beta-Hydrolases| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 171 STR:RPRED 95.5 SQ:SECSTR #####HHHHHHHHHHHGGEEEEEEEcccccccHHHHHHHHHHHHHHHTTccccHHHHHHHHTccEEEEEcccccGGGccHHHHHHHHccTTTcHHHHHHHcGGGGGGGEEEEEEETTcccccTHHHHHHHHHHHHHTcccEETTccccccTTHHHHHHHHHHHHHHTccccccccc### DISOP:02AL 1-5| PSIPRED ccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccccc //