[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81541.1
DDBJ      :             putative methylated-DNA-protein-cysteine methyltransferase
Swiss-Prot:             

Homologs  Archaea  26/68 : Bacteria  462/915 : Eukaryota  35/199 : Viruses  1/175   --->[See Alignment]
a.4.2c.55.7
:147 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   48->145 1wrjA PDBj 1e-11 35.4 %
:RPS:PDB   2->146 1eh6A PDBj 2e-24 29.2 %
:RPS:SCOP  2->68 1eh6A2  c.55.7.1 * 2e-06 16.7 %
:RPS:SCOP  67->146 1eh6A1  a.4.2.1 * 2e-20 37.5 %
:HMM:SCOP  65->146 1mgtA1 a.4.2.1 * 2.9e-21 49.4 %
:RPS:PFM   68->145 PF01035 * DNA_binding_1 1e-10 44.9 %
:HMM:PFM   70->146 PF01035 * DNA_binding_1 5.2e-23 48.1 77/85  
:BLT:SWISS 48->147 OGT_METS5 3e-17 45.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81541.1 GT:GENE AAS81541.1 GT:PRODUCT putative methylated-DNA-protein-cysteine methyltransferase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1162330..1162773) GB:FROM 1162330 GB:TO 1162773 GB:DIRECTION - GB:PRODUCT putative methylated-DNA-protein-cysteine methyltransferase GB:PROTEIN_ID AAS81541.1 GB:DB_XREF GI:46197127 LENGTH 147 SQ:AASEQ MWVPTPLGPLWLEVSPLGVRRLEPALYPRGPEAEGALALKVREAVQAYFAGERPDFLDLPLDYTGLSPARLRLYERVRLVPYGRTVSYGALGRELGLSPRAVGAALRACPFFLLVPAHRVIHADGRLGGFQGQEGLKLWLLRFEGAL GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 48->147|OGT_METS5|3e-17|45.9|98/156| BL:PDB:NREP 1 BL:PDB:REP 48->145|1wrjA|1e-11|35.4|96/150| RP:PDB:NREP 1 RP:PDB:REP 2->146|1eh6A|2e-24|29.2|144/168| RP:PFM:NREP 1 RP:PFM:REP 68->145|PF01035|1e-10|44.9|78/85|DNA_binding_1| HM:PFM:NREP 1 HM:PFM:REP 70->146|PF01035|5.2e-23|48.1|77/85|DNA_binding_1| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01035|IPR014048| GO:PFM GO:0006281|"GO:DNA repair"|PF01035|IPR014048| RP:SCP:NREP 2 RP:SCP:REP 2->68|1eh6A2|2e-06|16.7|66/78|c.55.7.1| RP:SCP:REP 67->146|1eh6A1|2e-20|37.5|80/90|a.4.2.1| HM:SCP:REP 65->146|1mgtA1|2.9e-21|49.4|81/0|a.4.2.1|1/1|Methylated DNA-protein cysteine methyltransferase, C-terminal domain| OP:NHOMO 578 OP:NHOMOORG 524 OP:PATTERN 11---11-111111111---------------1----------1111--11--1---1111---1--- -11-2---1111---1111-1211-211111-21111----211121111112-----11---1--231-11---111-1111-----11---1--1----1-112-1-1--------1--------111---1--111111111---------------------111-----------------1111111111111-111111111-1--11111---111-2-11121-111111111111111---11111----1--11111--111------111111111111111111111-------------1111--1111--2---------1-1--11----1111-----1112-111111--1-----1-1--2-----1-311---2222111111111111---1-----11--211122122112--1---1-1-111-1111111112---11-1------------1-----------------1-2-12--112111121111111231-1111222222211222---1--1211111-1---21-------111---111-1---1------111-1111---1-121------------111111111----1111111--1-111-11-1-----------------11--------11111--111-1111-1-111111111111111111----11111----------------11111111--111111111111---1-2--11111---1-111111111111111------111--1----112-1-1-1-----------------111111-111111-1-11---------1----------------11------------------1-----------11111112 ----1----------1-1-1111---11-1----------------1111--1-111--------------------------------------------------1--------------111----------1----2-1-1-1---1-------1-----1-----------1------1-----1----11--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 145 STR:RPRED 98.6 SQ:SECSTR #EEccTTccEEEEEETTEEEEEcccccccccccccHHHHHHHHHHHHHHHcGGGGGcccHHHHccccHHHHHHHHHHHHccTTccEEHHHHHHHTTccHHHHHHHTTcccccTTccGGGEEcTTccccccTTcHHHHHHHHHHTTc# PSIPRED ccccccccEEEEEEcccHHEEEEHHHcccccccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHccccccEEcHHHHHHHHcccHHHHHHHHHHccccccccccEEEccccccccccccHHHHHHHHHHcccc //