[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81550.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:68 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   54->67 PF12368 * DUF3650 1.6e-06 71.4 14/28  
:HMM:PFM   4->38 PF01402 * RHH_1 0.00039 32.4 34/39  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81550.1 GT:GENE AAS81550.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1171256..1171462) GB:FROM 1171256 GB:TO 1171462 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81550.1 GB:DB_XREF GI:46197136 LENGTH 68 SQ:AASEQ MRRIALPEDVAEALERFRRARGRGWRKALLHLAVEEERKALARLVWELRATAASHGLTEEEVARRLEG GT:EXON 1|1-68:0| SEG 11->30|aealerfrrargrgwrkall| HM:PFM:NREP 2 HM:PFM:REP 54->67|PF12368|1.6e-06|71.4|14/28|DUF3650| HM:PFM:REP 4->38|PF01402|0.00039|32.4|34/39|RHH_1| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 66-68| PSIPRED cccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcc //