[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81559.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:264 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   59->122 3gbjA PDBj 5e-05 42.2 %
:RPS:PFM   85->200 PF03783 * CsgG 2e-15 43.8 %
:HMM:PFM   35->252 PF03783 * CsgG 2.6e-57 40.0 190/209  
:BLT:SWISS 79->245 Y1126_NEIMB 6e-07 26.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81559.1 GT:GENE AAS81559.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1179908..1180702) GB:FROM 1179908 GB:TO 1180702 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81559.1 GB:DB_XREF GI:46197145 LENGTH 264 SQ:AASEQ MKRAWLLLGVFALSACAPQVTTKVDTGLSPDNPYATYTGPRAKVVVASFPCKAEKCGPGVDSSQVGAAVLGKLFGIEVSTSKGDIGAGIADMLTTALINSNHFIVYERSVLDQLQKESQIGNQAQQLQGAEILITGTITAFEPDAGGTRGGGGGLIGGLLGAVTGGQKKAYVAVDFRAVDVRTGAVVAAFRVEGEASDTDFGGLLGALVPGAALGGALSQYQKTPMGKALAVMVGKAVEELIRRIPPSYFKYGPDGQPVPQSAK GT:EXON 1|1-264:0| BL:SWS:NREP 1 BL:SWS:REP 79->245|Y1126_NEIMB|6e-07|26.5|151/223| SEG 146->166|ggtrgggggliggllgavtgg| SEG 202->218|ggllgalvpgaalggal| BL:PDB:NREP 1 BL:PDB:REP 59->122|3gbjA|5e-05|42.2|64/302| RP:PFM:NREP 1 RP:PFM:REP 85->200|PF03783|2e-15|43.8|112/193|CsgG| HM:PFM:NREP 1 HM:PFM:REP 35->252|PF03783|2.6e-57|40.0|190/209|CsgG| GO:PFM:NREP 1 GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03783|IPR005534| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------1--------------------------------------------11---1-------------------------------------------------1-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 64 STR:RPRED 24.2 SQ:SECSTR ##########################################################cEEEEEEEEEEEEEccccccccccccHHHHHHHHHHHHHHHccccccGGGcHHHHHTHHHHcTT############################################################################################################################################## DISOP:02AL 20-36, 82-83, 120-124, 253-264| PSIPRED cHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEEccHHHHHccccccccccHHccccccccccccccccccHHHHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHccEEEEEEEEEEEEEEEEcccccccccccEEEcccccccccEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEcEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHcccccccccccccccc //