[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81563.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->86 PF02628 * COX15-CtaA 0.00056 31.4 70/301  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81563.1 GT:GENE AAS81563.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1184235..1184618) GB:FROM 1184235 GB:TO 1184618 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81563.1 GB:DB_XREF GI:46197149 LENGTH 127 SQ:AASEQ MVGVFLHASLGLFLLVAVPALALVGLLGFFRPLPSRFYAFLRGVAWVAILQVLLGFLLFLQGLRPKDGLHLLYGLLLAAGLHYLGGLEPGGWFYRGLKDPPKRPELFVALGLLFCVGLVLRVYLTGR GT:EXON 1|1-127:0| TM:NTM 4 TM:REGION 5->27| TM:REGION 39->61| TM:REGION 66->88| TM:REGION 106->124| SEG 10->30|lglfllvavpalalvgllgff| SEG 50->63|lqvllgfllflqgl| SEG 68->87|glhllyglllaaglhylggl| HM:PFM:NREP 1 HM:PFM:REP 13->86|PF02628|0.00056|31.4|70/301|COX15-CtaA| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 73-73,81-81,118-118| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccc //