[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81568.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:141 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   101->129 PF07065 * D123 0.00083 42.9 28/298  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81568.1 GT:GENE AAS81568.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1188977..1189402) GB:FROM 1188977 GB:TO 1189402 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81568.1 GB:DB_XREF GI:46197154 LENGTH 141 SQ:AASEQ MRWLAGLLLLAQAVLGQGGAGGPVASPSGEYLGERALFRCLEVLKGLEVQAFYREGPDLLVLLGRERPLLVLALEGGRLWPHPRPPRGRPLPKRPFPFLRELTLAPWVLEVEGEYRCFVLHRGRVVGILRLDQDLRPLPLF GT:EXON 1|1-141:0| SEG 4->29|lagllllaqavlgqggaggpvaspsg| SEG 59->74|llvllgrerpllvlal| SEG 76->100|ggrlwphprpprgrplpkrpfpflr| SEG 129->140|lrldqdlrplpl| HM:PFM:NREP 1 HM:PFM:REP 101->129|PF07065|0.00083|42.9|28/298|D123| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 115-115,123-123| PSIPRED cHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccccEEEEEcccccEEEEEcccccEEEEEEcccEEcccccccccccccccccHHHHHcccccEEEEEcccEEEEEEEccEEEEEEEEcccccccccc //