[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81577.1
DDBJ      :             hypothetical protein
Swiss-Prot:Y1599_THET8  RecName: Full=UPF0133 protein TTHA1599;

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.222.1
:105 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  35->96 1j8bA  d.222.1.1 * 4e-07 35.6 %
:HMM:SCOP  3->96 1j8bA_ d.222.1.1 * 7.4e-21 48.9 %
:RPS:PFM   32->98 PF02575 * DUF149 2e-07 46.2 %
:HMM:PFM   7->98 PF02575 * DUF149 1.5e-26 45.6 90/93  
:BLT:SWISS 23->105 Y1599_THET8 2e-42 100.0 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81577.1 GT:GENE AAS81577.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1198642..1198959 GB:FROM 1198642 GB:TO 1198959 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81577.1 GB:DB_XREF GI:46197163 LENGTH 105 SQ:AASEQ MNFQKLLKEAQKAQKKAAEVQERLERMTVVGSAQGLVEVEANGHGKILALRLKPEALKAFQDDPEGLEDLLLVAIQDAQTKAHELSEKEMAKELGGVGQMLGKLF GT:EXON 1|1-105:0| SW:ID Y1599_THET8 SW:DE RecName: Full=UPF0133 protein TTHA1599; SW:GN OrderedLocusNames=TTHA1599; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 23->105|Y1599_THET8|2e-42|100.0|83/105| COIL:NAA 28 COIL:NSEG 1 COIL:REGION 2->29| SEG 4->22|qkllkeaqkaqkkaaevqe| RP:PFM:NREP 1 RP:PFM:REP 32->98|PF02575|2e-07|46.2|65/93|DUF149| HM:PFM:NREP 1 HM:PFM:REP 7->98|PF02575|1.5e-26|45.6|90/93|DUF149| RP:SCP:NREP 1 RP:SCP:REP 35->96|1j8bA|4e-07|35.6|59/92|d.222.1.1| HM:SCP:REP 3->96|1j8bA_|7.4e-21|48.9|88/92|d.222.1.1|1/1|YbaB-like| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18, 82-98| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHEEEEEccccEEEEEEEcccEEEEEEEcHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //