[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81580.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.7
:113 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  11->109 1vetB_ d.110.7.1 * 3.4e-07 30.3 %
:HMM:PFM   11->82 PF03259 * Robl_LC7 3.4e-08 30.6 72/91  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81580.1 GT:GENE AAS81580.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1199918..1200259 GB:FROM 1199918 GB:TO 1200259 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81580.1 GB:DB_XREF GI:46197166 LENGTH 113 SQ:AASEQ MAYLTGLSALGVDQAVFTGMDGLVIEALGQGPPSAEALAAELAALARRMDPLAQALGGKVLRFTLATEDREVLAVRVGEFLLGAVVHRGLNRKAVGQELSRIALRLEEAWREG GT:EXON 1|1-113:0| SEG 35->46|aealaaelaala| HM:PFM:NREP 1 HM:PFM:REP 11->82|PF03259|3.4e-08|30.6|72/91|Robl_LC7| HM:SCP:REP 11->109|1vetB_|3.4e-07|30.3|99/0|d.110.7.1|1/1|Roadblock/LC7 domain| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 112-113| PSIPRED ccHHHHHHHHHHHHHHHHcccccEEHEEcccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEEHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccc //