[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81581.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.7
:112 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  4->110 1vetB_ d.110.7.1 * 1.3e-10 30.8 %
:HMM:PFM   13->87 PF03259 * Robl_LC7 2.3e-09 38.7 75/91  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81581.1 GT:GENE AAS81581.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1200244..1200582 GB:FROM 1200244 GB:TO 1200582 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81581.1 GB:DB_XREF GI:46197167 LENGTH 112 SQ:AASEQ MEGRLREVLEGLLERGVRGAALLRPDGLLLEAVGEASGAAEQAAALLGLGVALAQSQGEEVAELVVEYPEGALFLAPVAGHHLLLLLEDLQDLGRARVALKGARLRIEEALA GT:EXON 1|1-112:0| SEG 2->19|egrlrevlegllergvrg| SEG 27->58|gllleavgeasgaaeqaaallglgvalaqsqg| SEG 83->93|llllledlqdl| HM:PFM:NREP 1 HM:PFM:REP 13->87|PF03259|2.3e-09|38.7|75/91|Robl_LC7| HM:SCP:REP 4->110|1vetB_|1.3e-10|30.8|107/0|d.110.7.1|1/1|Roadblock/LC7 domain| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccHHHHHHHHHHHccccccEEEccccHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //