[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81582.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->79 PF11950 * DUF3467 9e-16 56.0 %
:HMM:PFM   5->79 PF11950 * DUF3467 2.4e-23 38.7 75/92  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81582.1 GT:GENE AAS81582.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1200579..1200845 GB:FROM 1200579 GB:TO 1200845 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAS81582.1 GB:DB_XREF GI:46197168 LENGTH 88 SQ:AASEQ MNELKLDINIDKDVAQGRYANLALIAHTKNEFILDFALLQPQGGALVVSRIVTSPQHAKALLRSLAENIARYEEAFGPIPEPVAENQA GT:EXON 1|1-88:0| RP:PFM:NREP 1 RP:PFM:REP 5->79|PF11950|9e-16|56.0|75/86|DUF3467| HM:PFM:NREP 1 HM:PFM:REP 5->79|PF11950|2.4e-23|38.7|75/92|DUF3467| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------1111-111---111111111-1------------------------1---------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------11111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 80-88| PSIPRED ccccEEEEEEcHHHHcEEEEcEEEEccccHHHHHHHHHHccccccEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHccccccccccccc //