[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81585.1
DDBJ      :             probable thymidylate kinase
Swiss-Prot:KTHY_THET8   RecName: Full=Thymidylate kinase;         EC=2.7.4.9;AltName: Full=dTMP kinase;

Homologs  Archaea  59/68 : Bacteria  801/915 : Eukaryota  69/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:198 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->189 3hjnB PDBj 4e-38 50.3 %
:RPS:PDB   2->196 1e2mA PDBj 3e-14 16.9 %
:RPS:SCOP  3->198 1e2dA  c.37.1.1 * 3e-51 28.4 %
:HMM:SCOP  1->200 1e2kA_ c.37.1.1 * 1.7e-54 48.0 %
:RPS:PFM   9->185 PF02223 * Thymidylate_kin 2e-38 59.3 %
:HMM:PFM   8->189 PF02223 * Thymidylate_kin 3.6e-52 50.0 180/186  
:BLT:SWISS 1->198 KTHY_THET8 e-110 100.0 %
:PROS 88->100|PS01331|THYMIDYLATE_KINASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81585.1 GT:GENE AAS81585.1 GT:PRODUCT probable thymidylate kinase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1203507..1204103 GB:FROM 1203507 GB:TO 1204103 GB:DIRECTION + GB:PRODUCT probable thymidylate kinase GB:PROTEIN_ID AAS81585.1 GB:DB_XREF GI:46197171 LENGTH 198 SQ:AASEQ MPGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAEYLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRGLKPRLTFLLDLPPEAALRRVRRPDRLEGLGLEFFRRVREGYLALARAEPGRFVVLDATLPEEEIARAIQAHLRPLLP GT:EXON 1|1-198:0| SW:ID KTHY_THET8 SW:DE RecName: Full=Thymidylate kinase; EC=2.7.4.9;AltName: Full=dTMP kinase; SW:GN Name=tmk; OrderedLocusNames=TTHA1607; SW:KW ATP-binding; Complete proteome; Kinase; Nucleotide biosynthesis;Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->198|KTHY_THET8|e-110|100.0|198/198| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0009165|"GO:nucleotide biosynthetic process"|Nucleotide biosynthesis| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 88->100|PS01331|THYMIDYLATE_KINASE|PDOC01034| BL:PDB:NREP 1 BL:PDB:REP 4->189|3hjnB|4e-38|50.3|179/184| RP:PDB:NREP 1 RP:PDB:REP 2->196|1e2mA|3e-14|16.9|195/305| RP:PFM:NREP 1 RP:PFM:REP 9->185|PF02223|2e-38|59.3|177/188|Thymidylate_kin| HM:PFM:NREP 1 HM:PFM:REP 8->189|PF02223|3.6e-52|50.0|180/186|Thymidylate_kin| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF02223|IPR000062| RP:SCP:NREP 1 RP:SCP:REP 3->198|1e2dA|3e-51|28.4|190/209|c.37.1.1| HM:SCP:REP 1->200|1e2kA_|1.7e-54|48.0|198/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 982 OP:NHOMOORG 930 OP:PATTERN 111-1-22222222221111111111111111-1111-1-111111111111111111111-111--- 11211-----------------------------------121111111111111111111211---111111111111111111111--------------------1-1111111111111111111111111111111111111--1---11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1----------1---1------111--11--1111111111111--111111111112111111111111111111111111-11112111111111111111111111111111111111111111111111111-11111111111111111113111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111311221221111111-------11111111111111111111111111111111111111111111111-1111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111-1--------1114D421-111111111111111111111-1111111111 1-------------11-----1-----111111------------1111111111111111111----------------------11---1---111111-1---1----2211-----11-----1---------1----------1----1-1-11-21-1-3-1-----1111-------11--1-21---1--2 ---------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 197 STR:RPRED 99.5 SQ:SECSTR GEEEEEEEcccccccHHHHHHcccccEEEEcccHHHHHTTccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGEEEEEEccEEEEEEccTHHHHTHHHHTTcccHHHHHHHHHTcccccTTcEEEEEEccHHHHHHHHTTccTTccccHHHHHHHHHHHHHHHHHHTTccHHHHGGGGTcccccGGGcGGGGGH# PSIPRED ccccEEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHcc //