[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81586.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  208/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:151 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   36->140 PF02643 * DUF192 7e-23 54.9 %
:HMM:PFM   36->141 PF02643 * DUF192 1.1e-38 53.4 103/108  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81586.1 GT:GENE AAS81586.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1204111..1204566 GB:FROM 1204111 GB:TO 1204566 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAS81586.1 GB:DB_XREF GI:46197172 LENGTH 151 SQ:AASEQ MRHRLWGLLGLLGLALALTFPKSTLYVEGNGKRHLLKVEVADTPERWAQGLMFRERLGEDEGMVFLFPEPTAGGFWMKNTLIPLSIAFFDRQGVILRILDMEPCRADPCPVYYPGVVYQGALEVNQGWFRRRGLAEGARVGGEALKRWPQR GT:EXON 1|1-151:0| TM:NTM 1 TM:REGION 4->24| SEG 5->18|lwgllgllglalal| RP:PFM:NREP 1 RP:PFM:REP 36->140|PF02643|7e-23|54.9|102/108|DUF192| HM:PFM:NREP 1 HM:PFM:REP 36->141|PF02643|1.1e-38|53.4|103/108|DUF192| OP:NHOMO 216 OP:NHOMOORG 211 OP:PATTERN ------------------------------------------------------------------11 -------------------------------------------1--------------------------------------1-----------------2---11-1----------------------1---11---11-----111111111111--11111113211---------------11111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-------1--11111111------------111111111-1----111111111111111111111111111111111111-111------------------------------1111-1111111111111-111111111111111111111111111111111111111------------1111111-----------------------111111--------------------------------11--11-----------------------1---1---------------------------------------------------------------------------------------------------------1-----------------------------------------1---------------------------11111111111111--1-111111--------11----------------------------1--1-11111- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 150-151| PSIPRED cHHHHHHHHHHHHHHHHHccccccEEEEEcccEEEEEEEEEccHHHHHHHccccccccccccEEEEccccccEEEEEEEccccEEEEEEccccEEEEEEccccccccccccccccccEEEEEEccccHHHHHccccccEEEcHHHHccccc //