[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81588.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:78 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->40 PF09723 * CxxC_CxxC_SSSS 8e-05 37.5 %
:HMM:PFM   1->41 PF09723 * CxxC_CxxC_SSSS 1.2e-07 36.6 41/42  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81588.1 GT:GENE AAS81588.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1205101..1205337) GB:FROM 1205101 GB:TO 1205337 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAS81588.1 GB:DB_XREF GI:46197174 LENGTH 78 SQ:AASEQ MPIYVYKGLETGNYYEFEQGFHDEPLKAHPETGEPLKRVITPPAIIFKGSGWHVKDYAKKDSGAKKEEGSDTNKDKED GT:EXON 1|1-78:0| RP:PFM:NREP 1 RP:PFM:REP 1->40|PF09723|8e-05|37.5|40/41|CxxC_CxxC_SSSS| HM:PFM:NREP 1 HM:PFM:REP 1->41|PF09723|1.2e-07|36.6|41/42|CxxC_CxxC_SSSS| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --1---------------------------------------------------------------------------------------------------------1------------------------------------1-------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 56-78| PSIPRED cccccccccccHHHHHHHHcccccHHHccccccHHHEEEEccccEEEcccEEEEEccccccccccccccccccccccc //