[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81595.1
DDBJ      :             histidine nucleotide-binding protein
Swiss-Prot:             

Homologs  Archaea  51/68 : Bacteria  845/915 : Eukaryota  172/199 : Viruses  0/175   --->[See Alignment]
d.13.1
:107 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->105 1rzyA PDBj 2e-24 48.0 %
:RPS:SCOP  2->106 1av5A  d.13.1.1 * 8e-26 47.6 %
:HMM:SCOP  1->106 1emsA1 d.13.1.1 * 2.4e-33 41.9 %
:RPS:PFM   2->103 PF11969 * DcpS_C 7e-18 41.0 %
:HMM:PFM   11->105 PF01230 * HIT 1.9e-30 45.6 90/98  
:BLT:SWISS 2->105 YHIT_AQUAE 4e-27 49.0 %
:PROS 86->104|PS00892|HIT_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81595.1 GT:GENE AAS81595.1 GT:PRODUCT histidine nucleotide-binding protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1208915..1209238) GB:FROM 1208915 GB:TO 1209238 GB:DIRECTION - GB:PRODUCT histidine nucleotide-binding protein GB:PROTEIN_ID AAS81595.1 GB:DB_XREF GI:46197181 LENGTH 107 SQ:AASEQ MECVFCRIIAGELPSKKVYEDEGFVAFHDIRPKAPVHVLVVPKEHVEKLSDYPDTEEGERKLGALFRTANRVARVLGLEGYRVQVNVGEKGGQEVFHVHVHVMGGWG GT:EXON 1|1-107:0| BL:SWS:NREP 1 BL:SWS:REP 2->105|YHIT_AQUAE|4e-27|49.0|102/121| PROS 86->104|PS00892|HIT_1|PDOC00694| BL:PDB:NREP 1 BL:PDB:REP 2->105|1rzyA|2e-24|48.0|102/114| RP:PFM:NREP 1 RP:PFM:REP 2->103|PF11969|7e-18|41.0|100/113|DcpS_C| HM:PFM:NREP 1 HM:PFM:REP 11->105|PF01230|1.9e-30|45.6|90/98|HIT| RP:SCP:NREP 1 RP:SCP:REP 2->106|1av5A|8e-26|47.6|103/113|d.13.1.1| HM:SCP:REP 1->106|1emsA1|2.4e-33|41.9|105/160|d.13.1.1|1/1|HIT-like| OP:NHOMO 1253 OP:NHOMOORG 1068 OP:PATTERN 11-1--11111111121111111-11111111---11111111---1--1111-111-1--111-211 111-2--1------31111-11--11111111211123111-121-111111--1-1-1121111221111111111111121111111111-1111---11--1--11-1111111111111111111111111111111111-211111111111111-111111111111111111111111111--11111111111111111112122111111111111111111211111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111211111111112111111111131121111111111111211111111111111111--1111111-111-1111-111111-11111112111111111111111-111111111111111111111---1111-111111111111112212222222211112222111111222222111-1-111222111111111111111111111111212-11111---111111121111111111112111111111111111111111111111111111111111111111111111111111111--1111---11111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-3333121121111111111111111111111111111111111111111111111111111111111111111--1111-1-1-1-111---11111111111-11-----111 1111211-311111-1111-11111-111-1-111111111111-1111-1111111-11-1-11111-111111-1----1111111-324132211-1112211-231421222-1-32-2136-22293-2252122412322112-21-31122231213221224111321112E1111123351242212211 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 106 STR:RPRED 99.1 SQ:SECSTR #ccHHHHHHTTcccccEEEEcccEEEEEcccccccEEEEEEEccccccGGGccGGGHHGGHHHHHHHHHHHHHHHTTcTcEEEEcccHHHHTcccccccEEEEEccc DISOP:02AL 106-108| PSIPRED cccHHHHHHccccccEEEEEcccEEEEEcccccccEEEEEEEccccccHHHccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccHHHccEEEEEEEEEEcccc //