[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81599.1
DDBJ      :             small heat shock protein
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  357/915 : Eukaryota  38/199 : Viruses  0/175   --->[See Alignment]
b.15.1
:154 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   44->139 3glaA PDBj 5e-11 32.3 %
:RPS:PDB   49->143 2byuA PDBj 4e-20 32.6 %
:RPS:SCOP  41->151 1shsA  b.15.1.1 * 1e-22 26.1 %
:HMM:SCOP  6->154 1gmeA_ b.15.1.1 * 3.7e-36 32.2 %
:RPS:PFM   51->151 PF00011 * HSP20 2e-13 41.0 %
:HMM:PFM   53->150 PF00011 * HSP20 2.5e-25 33.3 96/102  
:BLT:SWISS 14->150 SP21_STIAU 5e-19 39.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81599.1 GT:GENE AAS81599.1 GT:PRODUCT small heat shock protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1212682..1213146) GB:FROM 1212682 GB:TO 1213146 GB:DIRECTION - GB:PRODUCT small heat shock protein GB:PROTEIN_ID AAS81599.1 GB:DB_XREF GI:46197185 LENGTH 154 SQ:AASEQ MTLVRRDARPMELTPFRTWSPFTLVDEVNRLFEEAFSDLVRPAAAYVAPADLYETDEALILEMAVPGMTPEDLEVSLEGNKLTIRGQVKPVADERVRRYYLQEMAHGSFVRTFTLPVEVDASGVKAEFRNGILRLTLPKVAEARARRIPIEVVQ GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 14->150|SP21_STIAU|5e-19|39.0|136/188| BL:PDB:NREP 1 BL:PDB:REP 44->139|3glaA|5e-11|32.3|96/97| RP:PDB:NREP 1 RP:PDB:REP 49->143|2byuA|4e-20|32.6|95/101| RP:PFM:NREP 1 RP:PFM:REP 51->151|PF00011|2e-13|41.0|100/101|HSP20| HM:PFM:NREP 1 HM:PFM:REP 53->150|PF00011|2.5e-25|33.3|96/102|HSP20| RP:SCP:NREP 1 RP:SCP:REP 41->151|1shsA|1e-22|26.1|111/115|b.15.1.1| HM:SCP:REP 6->154|1gmeA_|3.7e-36|32.2|149/0|b.15.1.1|1/1|HSP20-like chaperones| OP:NHOMO 729 OP:NHOMOORG 408 OP:PATTERN ----------------------------2111--1----------1-111121------------1-- 1121----------133-----1111-----11111-13221212----11212111-----11--22--2-----------511211111-1---1--1-2-1111332---------------22121222212111221-11443242222111-----1-1112263------------2114422--1---------1--1----111-----111-------------------------------1-----------------1----1------------------------------------------1----1----2221221-2-1-111----11--2-1-2211-21113111111---222--4-----1-41433211-11----------4-1411532113------1151-1-2-------1-1-----11111111111-----------------------3-1------11-1--3------4222233244433-5444433118233---53-24111-3-1212-231-11--------11321-36241246122334-41453623313422355--------------------1111122--1-21--1-11-----------1----1----3112-------------------------------------------1------------------------------------------------11111111125-23--------------------------21---------4-1-1----11111-111----------------111111111111--3-111111-----1--1---------------------------111111111111- 1-----1-1-----2---1-11-1-11----------211111-------------1-----1-----1-----------2-----27-3-2--31-----2-1-1---4-----------------------------------------------------------------2-1-----113161---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 72.1 SQ:SECSTR ########################################ccccEEEEcEEEEEcccEEEEEEEcTTccGGGEEEEEETTEEEEEEccccccccTTccccccccccccEEEEEEccccccGGGcEEEEETTEEEEEEEccccccccccccc### DISOP:02AL 90-97, 143-146| PSIPRED ccEEEccccccccccccccccHHHHHHHHHHHHHHcccccccccccccEEEEEEcccEEEEEEEEcccccccEEEEEEccEEEEEEEEccccccccccEEEEcEEccEEEEEEEccccccccEEEEEEEccEEEEEEcccccccccEEEEEEEc //