[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81604.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:196 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->145 PF06168 * DUF981 1e-06 38.4 %
:HMM:PFM   1->190 PF06168 * DUF981 2.2e-50 38.0 184/191  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81604.1 GT:GENE AAS81604.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1215781..1216371) GB:FROM 1215781 GB:TO 1216371 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAS81604.1 GB:DB_XREF GI:46197190 LENGTH 196 SQ:AASEQ MGSYNPLVFVLGLVTAAGVSGVAYLLAVARGGDEKALGRLYGPLFFTLGVFSLGAVAQLYWTNWAGRPVPHYTELFGVATGLFAFMMVLAGFYLYQGLELKALAWPSAFLGLYLLQGARAVLDFGLTRNPPLTALMWGAAGLASLGILFYAYSRPEARRTWAYLGALVLALMALGAFLTGFMAYYGHIASAVGGGG GT:EXON 1|1-196:0| TM:NTM 5 TM:REGION 7->29| TM:REGION 39->61| TM:REGION 72->94| TM:REGION 130->151| TM:REGION 162->184| SEG 162->178|aylgalvlalmalgafl| RP:PFM:NREP 1 RP:PFM:REP 1->145|PF06168|1e-06|38.4|138/190|DUF981| HM:PFM:NREP 1 HM:PFM:REP 1->190|PF06168|2.2e-50|38.0|184/191|DUF981| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 195-196| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //