[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81618.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.32
:194 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  5->129 1vpqA_ c.1.32.1 * 6.7e-05 26.9 %
:HMM:PFM   21->123 PF01904 * DUF72 2.7e-07 31.0 100/230  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81618.1 GT:GENE AAS81618.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1229267..1229851 GB:FROM 1229267 GB:TO 1229851 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81618.1 GB:DB_XREF GI:46197204 LENGTH 194 SQ:AASEQ MRPGSEILVGLRGYRGFPGGFKAYRKAFPTVELSWWHRVGDVGTISRLRALAPEGFRFSAVGHKHLTFRPTGEERRVLRRLLRRFRLFGPKAGALRLLLPEDLSPEALEAWLPLLEAVQNELGPVPIAFQAPAPLKPLLLERGLAVVNAEEGPFLYLLDPERLPPGKGYAYFAPERVFPNPPPGPTLGEEVEGR GT:EXON 1|1-194:0| SEG 75->88|rrvlrrllrrfrlf| SEG 103->117|lspealeawlpllea| HM:PFM:NREP 1 HM:PFM:REP 21->123|PF01904|2.7e-07|31.0|100/230|DUF72| HM:SCP:REP 5->129|1vpqA_|6.7e-05|26.9|119/0|c.1.32.1|1/1|TM1631-like| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 187-194| PSIPRED ccccHHEEEEccccccccHHHHHHHHHcccEEEHHHHHccccHHHHHHHHHccccEEEEEEcccEEEEccccHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHcccEEEEcccccEEEEEccccccccccEEEEcccccccccccccccccccccc //