[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81626.1
DDBJ      :             nucleotidyltransferase
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  72/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.24.16
:111 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  10->108 1wtyA  a.24.16.2 * 7e-10 21.3 %
:HMM:SCOP  66->108 1wtyA_ a.24.16.2 * 0.00011 34.9 %
:RPS:PFM   11->100 PF01934 * DUF86 4e-13 38.9 %
:HMM:PFM   11->105 PF01934 * DUF86 1.1e-27 34.7 95/119  
:BLT:SWISS 2->108 Y101_METAC 2e-19 42.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81626.1 GT:GENE AAS81626.1 GT:PRODUCT nucleotidyltransferase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1239720..1240055) GB:FROM 1239720 GB:TO 1240055 GB:DIRECTION - GB:PRODUCT nucleotidyltransferase GB:PROTEIN_ID AAS81626.1 GB:DB_XREF GI:46197212 LENGTH 111 SQ:AASEQ MRNPRERLLDILEAIARIERYAALGKARFLQDELVQVWIVHHLERIGEAAARLGREFHEAHPHIPWREMVAMRNLLVHEYFSVDLEEVWSTVVRDLPALKVQVQALLEVDP GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 2->108|Y101_METAC|2e-19|42.1|107/119| RP:PFM:NREP 1 RP:PFM:REP 11->100|PF01934|4e-13|38.9|90/118|DUF86| HM:PFM:NREP 1 HM:PFM:REP 11->105|PF01934|1.1e-27|34.7|95/119|DUF86| RP:SCP:NREP 1 RP:SCP:REP 10->108|1wtyA|7e-10|21.3|94/116|a.24.16.2| HM:SCP:REP 66->108|1wtyA_|0.00011|34.9|43/0|a.24.16.2|1/1|Nucleotidyltransferase substrate binding subunit/domain| OP:NHOMO 138 OP:NHOMOORG 81 OP:PATTERN ------------------------------------4------2-141--413----1---------- -1-1--------------------------------------1-------------------------------------1------------1------------------------------------4-----1--35------3754531-22------1312----------------1-122---------------------------------------------------------------------------------------------------------------------------------------1--------------------------------11-1-4-11---11---13--11------1-----------1-------------------1--------------------------------------------2-1--------------------------------------------------------------1-----------------1--1--1-1-----------1--11------------------111-1-------------------------------------------------------------2--------1-12-------1--------------------------------------------------------------------------------------------------1-------------------------1--------------1----------------------------------------1----11------------1---------------------------11--1-1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccc //