[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81641.1
DDBJ      :             LSU ribosomal protein L17P
Swiss-Prot:RL17_THET8   RecName: Full=50S ribosomal protein L17;

Homologs  Archaea  0/68 : Bacteria  906/915 : Eukaryota  149/199 : Viruses  0/175   --->[See Alignment]
d.188.1
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->118 1vsaL PDBj 7e-65 100.0 %
:RPS:PDB   1->117 3bboP PDBj 5e-39 46.6 %
:RPS:SCOP  14->118 1gd8A  d.188.1.1 * 1e-36 100.0 %
:HMM:SCOP  14->118 1gd8A_ d.188.1.1 * 1.9e-41 63.8 %
:RPS:PFM   20->117 PF01196 * Ribosomal_L17 6e-22 61.9 %
:HMM:PFM   20->117 PF01196 * Ribosomal_L17 3.6e-40 58.8 97/97  
:BLT:SWISS 1->118 RL17_THET8 2e-64 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81641.1 GT:GENE AAS81641.1 GT:PRODUCT LSU ribosomal protein L17P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1252218..1252574) GB:FROM 1252218 GB:TO 1252574 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L17P GB:PROTEIN_ID AAS81641.1 GB:DB_XREF GI:46197227 LENGTH 118 SQ:AASEQ MRHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHLIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKLAERRRGDGAPLALVELVE GT:EXON 1|1-118:0| SW:ID RL17_THET8 SW:DE RecName: Full=50S ribosomal protein L17; SW:GN Name=rplQ; Synonyms=rpl17; OrderedLocusNames=TTHA1663; SW:KW 3D-structure; Complete proteome; Direct protein sequencing;Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->118|RL17_THET8|2e-64|100.0|118/118| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 1->118|1vsaL|7e-65|100.0|118/118| RP:PDB:NREP 1 RP:PDB:REP 1->117|3bboP|5e-39|46.6|116/116| RP:PFM:NREP 1 RP:PFM:REP 20->117|PF01196|6e-22|61.9|97/97|Ribosomal_L17| HM:PFM:NREP 1 HM:PFM:REP 20->117|PF01196|3.6e-40|58.8|97/97|Ribosomal_L17| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01196|IPR000456| GO:PFM GO:0005622|"GO:intracellular"|PF01196|IPR000456| GO:PFM GO:0005840|"GO:ribosome"|PF01196|IPR000456| GO:PFM GO:0006412|"GO:translation"|PF01196|IPR000456| RP:SCP:NREP 1 RP:SCP:REP 14->118|1gd8A|1e-36|100.0|105/105|d.188.1.1| HM:SCP:REP 14->118|1gd8A_|1.9e-41|63.8|105/105|d.188.1.1|1/1|Prokaryotic ribosomal protein L17| OP:NHOMO 1116 OP:NHOMOORG 1055 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111-11111-11111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-111111111111111111111111111-1111 22--111-41---11111-111111111111-1111111111111111111111-11111111--111--11-1-111111----111--111111----121112--41111111-2-1111-11111151-111-11-1111111-1-11-111111--------------112222I2112243441322221112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 100.0 SQ:SECSTR ccTTcccccTTccGGGHHHHHHHHHHHHHHTccEEEcHHHHHHHHHHHHHHHHHHHHcTTHHHHHHHTTcccTTHHHHHTTccGGGGcccccccEEcccccccccccccccEEEEEcc DISOP:02AL 1-12| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHccEEEEcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccEEEEEEcc //