[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81644.1
DDBJ      :             SSU ribosomal protein S11P
Swiss-Prot:RS11_THET8   RecName: Full=30S ribosomal protein S11;

Homologs  Archaea  24/68 : Bacteria  906/915 : Eukaryota  60/199 : Viruses  0/175   --->[See Alignment]
c.55.4
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->129 2j00K PDBj 2e-56 100.0 %
:RPS:PDB   12->125 2e5lK PDBj 7e-34 86.8 %
:RPS:SCOP  12->129 1fjgK  c.55.4.1 * 2e-35 87.3 %
:HMM:SCOP  11->127 1fjgK_ c.55.4.1 * 8.4e-42 56.4 %
:RPS:PFM   19->126 PF00411 * Ribosomal_S11 5e-25 54.6 %
:HMM:PFM   17->126 PF00411 * Ribosomal_S11 3.1e-44 53.6 110/110  
:BLT:SWISS 12->129 RS11_THET8 7e-56 100.0 %
:PROS 95->117|PS00054|RIBOSOMAL_S11
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81644.1 GT:GENE AAS81644.1 GT:PRODUCT SSU ribosomal protein S11P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1254187..1254576) GB:FROM 1254187 GB:TO 1254576 GB:DIRECTION - GB:PRODUCT SSU ribosomal protein S11P GB:PROTEIN_ID AAS81644.1 GB:DB_XREF GI:46197230 LENGTH 129 SQ:AASEQ MAKKPSKKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS GT:EXON 1|1-129:0| SW:ID RS11_THET8 SW:DE RecName: Full=30S ribosomal protein S11; SW:GN Name=rpsK; Synonyms=rps11; OrderedLocusNames=TTHA1666; SW:KW 3D-structure; Complete proteome; Direct protein sequencing;Ribonucleoprotein; Ribosomal protein; RNA-binding; rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 12->129|RS11_THET8|7e-56|100.0|118/129| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 95->117|PS00054|RIBOSOMAL_S11|PDOC00053| SEG 3->11|kkpskkkvk| SEG 60->74|aaqlaaldaakkama| BL:PDB:NREP 1 BL:PDB:REP 12->129|2j00K|2e-56|100.0|118/119| RP:PDB:NREP 1 RP:PDB:REP 12->125|2e5lK|7e-34|86.8|114/115| RP:PFM:NREP 1 RP:PFM:REP 19->126|PF00411|5e-25|54.6|108/109|Ribosomal_S11| HM:PFM:NREP 1 HM:PFM:REP 17->126|PF00411|3.1e-44|53.6|110/110|Ribosomal_S11| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00411|IPR001971| GO:PFM GO:0005622|"GO:intracellular"|PF00411|IPR001971| GO:PFM GO:0005840|"GO:ribosome"|PF00411|IPR001971| GO:PFM GO:0006412|"GO:translation"|PF00411|IPR001971| RP:SCP:NREP 1 RP:SCP:REP 12->129|1fjgK|2e-35|87.3|118/119|c.55.4.1| HM:SCP:REP 11->127|1fjgK_|8.4e-42|56.4|117/0|c.55.4.1|1/1|Translational machinery components| OP:NHOMO 1017 OP:NHOMOORG 990 OP:PATTERN --------11111111----------111111------111111-1------------1---11---- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111--1--111111111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ------------11----------------------------------------------------------------------------------------1111----12111211---11-11-1-362-213111-11-11-1---1111-1112---1111-11111112212------2-1-5--2------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 91.5 SQ:SECSTR ###########cccccEEEEEEccccccEEEEEcTTccEEEEEccTTTTcccGGGGcHHHHHHHHHHHHHTTGGGTccEEEEEEEcccccHHHHHHHHHHHTcEEEEEEEccccccccccccccccTcc DISOP:02AL 1-12, 121-129| PSIPRED ccccccccccEEcccEEEEEEEEEcccEEEEEEEccccEEEEEEccccEEEccccccHHHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHccEEEEEEEEccccccccccccccccccc //