[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81649.1
DDBJ      :             adenylate kinase
Swiss-Prot:KAD_THET8    RecName: Full=Adenylate kinase;         Short=AK;         EC=2.7.4.3;AltName: Full=ATP-AMP transphosphorylase;

Homologs  Archaea  22/68 : Bacteria  863/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:186 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->186 3cm0A PDBj 4e-76 100.0 %
:RPS:PDB   7->185 3dl0A PDBj 3e-38 36.3 %
:RPS:SCOP  7->184 1knqA  c.37.1.17 * 2e-12 11.8 %
:HMM:SCOP  1->185 3adkA_ c.37.1.1 * 7e-44 40.9 %
:RPS:PFM   10->161 PF00406 * ADK 3e-23 43.6 %
:HMM:PFM   10->162 PF00406 * ADK 1.5e-52 51.4 144/151  
:BLT:SWISS 1->186 KAD_THET8 6e-77 100.0 %
:PROS 80->91|PS00113|ADENYLATE_KINASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81649.1 GT:GENE AAS81649.1 GT:PRODUCT adenylate kinase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1256122..1256682) GB:FROM 1256122 GB:TO 1256682 GB:DIRECTION - GB:PRODUCT adenylate kinase GB:PROTEIN_ID AAS81649.1 GB:DB_XREF GI:46197235 LENGTH 186 SQ:AASEQ MDVGQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVARGTPLGERVRPIMERGDLVPDDLILELIREELAERVIFDGFPRTLAQAEALDRLLSETGTRLLGVVLVEVPEEELVRRILRRAELEGRSDDNEETVRRRLEVYREKTEPLVGYYEARGVLKRVDGLGTPDEVYARIRAALGI GT:EXON 1|1-186:0| SW:ID KAD_THET8 SW:DE RecName: Full=Adenylate kinase; Short=AK; EC=2.7.4.3;AltName: Full=ATP-AMP transphosphorylase; SW:GN Name=adk; OrderedLocusNames=TTHA1671; SW:KW 3D-structure; ATP-binding; Complete proteome; Cytoplasm; Kinase;Nucleotide biosynthesis; Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->186|KAD_THET8|6e-77|100.0|186/186| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0009165|"GO:nucleotide biosynthetic process"|Nucleotide biosynthesis| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 80->91|PS00113|ADENYLATE_KINASE|PDOC00104| SEG 67->79|lilelireelaer| SEG 105->130|rllgvvlvevpeeelvrrilrraele| BL:PDB:NREP 1 BL:PDB:REP 3->186|3cm0A|4e-76|100.0|184/184| RP:PDB:NREP 1 RP:PDB:REP 7->185|3dl0A|3e-38|36.3|179/216| RP:PFM:NREP 1 RP:PFM:REP 10->161|PF00406|3e-23|43.6|149/159|ADK| HM:PFM:NREP 1 HM:PFM:REP 10->162|PF00406|1.5e-52|51.4|144/151|ADK| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00406|IPR000850| GO:PFM GO:0006139|"GO:nucleobase, nucleoside, nucleotide and nucleic acid metabolic process"|PF00406|IPR000850| GO:PFM GO:0019205|"GO:nucleobase, nucleoside, nucleotide kinase activity"|PF00406|IPR000850| RP:SCP:NREP 1 RP:SCP:REP 7->184|1knqA|2e-12|11.8|161/171|c.37.1.17| HM:SCP:REP 1->185|3adkA_|7e-44|40.9|181/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1732 OP:NHOMOORG 1080 OP:PATTERN --1-1-----------2------11--11111----------------11111-11111-1---1--- 1221111111111111111-11111111111111111122122311111111313111111111112111111111111111111111111111111--11111111111-------11111111111111111112222211121211111111111111111211222111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-112111111111111111221211111112112222222111111111111111111111111----11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111212111-111111-1-------1111-111111111111111111111111111111211-1111211----11111111111111111-111111111111111111111111111-111111111111111111111111-111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111211-11111111-1---21-111111----111-11---1111111111111 1112132-A4324443221222211132211112223323333111332122221131322132213213112133322314332321-22223231111132414-33394B66524453654C3394GbC-99D2323823742432254272347734354342737833537675*53344C7BA28A2458567 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 100.0 SQ:SECSTR TTTEEEEEEEccTTccHHHHHHHHHHHccccEEEHHHHHHHHHHTTcHHHHHHHHHHTTTccccHHHHHHHTcGGGTTcEEEEcccccHHHHHHHHHHHHHTTTTccEEETTTcccccTTccTTTcccEEccTTccHHHHHHHHHHHHHHHHHHHHHHHHHTcEEEEEccccHHHHHHHHHHHHGc DISOP:02AL 1-2, 124-133| PSIPRED cccccEEEEEccccccHHHHHHHHHHHcccEEEcHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcc //