[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81653.1
DDBJ      :             SSU ribosomal protein S5P
Swiss-Prot:RS5_THETH    RecName: Full=30S ribosomal protein S5;

Homologs  Archaea  64/68 : Bacteria  909/915 : Eukaryota  181/199 : Viruses  0/175   --->[See Alignment]
d.14.1d.50.1
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->157 1fkaE PDBj 1e-86 100.0 %
:RPS:PDB   5->155 3d5aE PDBj 7e-44 100.0 %
:RPS:SCOP  5->73 1fjgE2  d.50.1.2 * 2e-17 100.0 %
:RPS:SCOP  74->154 1fjgE1  d.14.1.1 * 5e-14 100.0 %
:HMM:SCOP  5->73 1fjgE2 d.50.1.2 * 1.5e-22 55.1 %
:HMM:SCOP  74->154 1fjgE1 d.14.1.1 * 1e-24 53.1 %
:RPS:PFM   7->71 PF00333 * Ribosomal_S5 2e-13 55.4 %
:RPS:PFM   85->153 PF03719 * Ribosomal_S5_C 2e-18 59.4 %
:HMM:PFM   80->153 PF03719 * Ribosomal_S5_C 3.1e-32 58.1 74/74  
:HMM:PFM   5->70 PF00333 * Ribosomal_S5 3.6e-28 54.5 66/67  
:BLT:SWISS 1->162 RS5_THETH 6e-89 100.0 %
:PROS 23->55|PS00585|RIBOSOMAL_S5

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81653.1 GT:GENE AAS81653.1 GT:PRODUCT SSU ribosomal protein S5P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1258616..1259104) GB:FROM 1258616 GB:TO 1259104 GB:DIRECTION - GB:PRODUCT SSU ribosomal protein S5P GB:PROTEIN_ID AAS81653.1 GB:DB_XREF GI:46197239 LENGTH 162 SQ:AASEQ MPETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAHAQAQG GT:EXON 1|1-162:0| SW:ID RS5_THETH SW:DE RecName: Full=30S ribosomal protein S5; SW:GN Name=rpsE; Synonyms=rps5; SW:KW 3D-structure; Direct protein sequencing; Ribonucleoprotein;Ribosomal protein; RNA-binding; rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->162|RS5_THETH|6e-89|100.0|162/162| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 23->55|PS00585|RIBOSOMAL_S5|PDOC00505| BL:PDB:NREP 1 BL:PDB:REP 1->157|1fkaE|1e-86|100.0|157/157| RP:PDB:NREP 1 RP:PDB:REP 5->155|3d5aE|7e-44|100.0|151/151| RP:PFM:NREP 2 RP:PFM:REP 7->71|PF00333|2e-13|55.4|65/67|Ribosomal_S5| RP:PFM:REP 85->153|PF03719|2e-18|59.4|69/74|Ribosomal_S5_C| HM:PFM:NREP 2 HM:PFM:REP 80->153|PF03719|3.1e-32|58.1|74/74|Ribosomal_S5_C| HM:PFM:REP 5->70|PF00333|3.6e-28|54.5|66/67|Ribosomal_S5| GO:PFM:NREP 9 GO:PFM GO:0003723|"GO:RNA binding"|PF00333|IPR013810| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00333|IPR013810| GO:PFM GO:0005622|"GO:intracellular"|PF00333|IPR013810| GO:PFM GO:0005840|"GO:ribosome"|PF00333|IPR013810| GO:PFM GO:0006412|"GO:translation"|PF00333|IPR013810| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF03719|IPR005324| GO:PFM GO:0005622|"GO:intracellular"|PF03719|IPR005324| GO:PFM GO:0005840|"GO:ribosome"|PF03719|IPR005324| GO:PFM GO:0006412|"GO:translation"|PF03719|IPR005324| RP:SCP:NREP 2 RP:SCP:REP 5->73|1fjgE2|2e-17|100.0|69/69|d.50.1.2| RP:SCP:REP 74->154|1fjgE1|5e-14|100.0|81/81|d.14.1.1| HM:SCP:REP 5->73|1fjgE2|1.5e-22|55.1|69/69|d.50.1.2|1/1|dsRNA-binding domain-like| HM:SCP:REP 74->154|1fjgE1|1e-24|53.1|81/81|d.14.1.1|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 1396 OP:NHOMOORG 1154 OP:PATTERN 11111111111111111111111111111111111-111111-111111111111111111-11-111 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ---1112142212212212111212111111112221111111111111111111121122221122221221112222221-11122-2312221111-11235411-2511112211---315C1944M5-26G21-15-11111---1-12111111-221221313311132223g4333252662821122222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 96.9 SQ:SECSTR EEEEccEEEEEEEEEEEccccccccEEEEEEEEEEcccccEEEEEEEEccHHHHHHHHHHHHHHccccccccTTcccccEEEEETTEEEEEEEccTTcEEEccHHHHHHHHTTTccEEEEEEEEcccHHHHHHHHHHHHHHcccHHHHHHHHHcccc##### DISOP:02AL 157-159| PSIPRED ccccccccEEEEEcccEEEEcccEEEEEEEEEEEEccccEEEEEEcccccccHHHHHHHHHHHHcEEEEEEEcccccccEEEEEccEEEEEEEcccccEEEcccHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHccccHHHHHHHcccccEEEEcc //