[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81657.1
DDBJ      :             SSU ribosomal protein S14P
Swiss-Prot:RS14Z_THETH  RecName: Full=30S ribosomal protein S14 type Z;

Homologs  Archaea  0/68 : Bacteria  371/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
g.39.1
:61 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->61 2j00N PDBj 2e-32 100.0 %
:RPS:PDB   9->61 3bbnN PDBj 2e-14 35.8 %
:RPS:SCOP  2->61 1fjgN  g.39.1.7 * 5e-20 100.0 %
:HMM:SCOP  2->61 1fjgN_ g.39.1.7 * 3.8e-21 53.3 %
:RPS:PFM   19->60 PF00253 * Ribosomal_S14 6e-09 69.0 %
:HMM:PFM   10->60 PF00253 * Ribosomal_S14 2e-26 54.9 51/55  
:BLT:SWISS 1->61 RS14Z_THETH 5e-33 100.0 %
:PROS 23->45|PS00527|RIBOSOMAL_S14

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81657.1 GT:GENE AAS81657.1 GT:PRODUCT SSU ribosomal protein S14P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1260496..1260681) GB:FROM 1260496 GB:TO 1260681 GB:DIRECTION - GB:PRODUCT SSU ribosomal protein S14P GB:PROTEIN_ID AAS81657.1 GB:DB_XREF GI:46197243 LENGTH 61 SQ:AASEQ MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW GT:EXON 1|1-61:0| SW:ID RS14Z_THETH SW:DE RecName: Full=30S ribosomal protein S14 type Z; SW:GN Name=rpsZ; Synonyms=rps14, rpsN; SW:KW 3D-structure; Metal-binding; Ribonucleoprotein; Ribosomal protein;RNA-binding; rRNA-binding; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->61|RS14Z_THETH|5e-33|100.0|61/61| GO:SWS:NREP 5 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 23->45|PS00527|RIBOSOMAL_S14|PDOC00456| BL:PDB:NREP 1 BL:PDB:REP 2->61|2j00N|2e-32|100.0|60/60| RP:PDB:NREP 1 RP:PDB:REP 9->61|3bbnN|2e-14|35.8|53/99| RP:PFM:NREP 1 RP:PFM:REP 19->60|PF00253|6e-09|69.0|42/55|Ribosomal_S14| HM:PFM:NREP 1 HM:PFM:REP 10->60|PF00253|2e-26|54.9|51/55|Ribosomal_S14| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00253|IPR001209| GO:PFM GO:0005622|"GO:intracellular"|PF00253|IPR001209| GO:PFM GO:0005840|"GO:ribosome"|PF00253|IPR001209| GO:PFM GO:0006412|"GO:translation"|PF00253|IPR001209| RP:SCP:NREP 1 RP:SCP:REP 2->61|1fjgN|5e-20|100.0|60/60|g.39.1.7| HM:SCP:REP 2->61|1fjgN_|3.8e-21|53.3|60/60|g.39.1.7|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 381 OP:NHOMOORG 373 OP:PATTERN -------------------------------------------------------------------- 11111---------11111-11111111111111111111111111111-----------1111111111111111111111111111--------------------1-----------------1---11-----11111111--------11---11111---1-----1-----1--1-1111111111111111111111111121221211111111--11111111111111111111111111121-111-11-2111111--11---111111111111111111111111111111111-1111--1111111111111111111111111111111-11111-111111-1111111111---11------------------------------------------------------------------------------------------------------------------1111--1---------------------------------------------------------------------------1111-11111111-1111111111111111111111111111--111111-1-11111--------------------------------1------------------------------------------------------------------------------------------------------1111-----------------------------------------------------------------------------------------1-1-12111111111111-----1-111-1111111-111111111111111111-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 98.4 SQ:SECSTR #ccHHHHHccccccccGGGcccccccccccccccTTTcccTTHHHHHHTTTcccccccccc DISOP:02AL 1-2, 8-18| PSIPRED ccHHHHHHHHHHccccccEEEEEEEEcccccEEEccccccHHHHHHHHHcccccccEEccc //