[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81661.1
DDBJ      :             SSU ribosomal protein S17P
Swiss-Prot:RS17_THETH   RecName: Full=30S ribosomal protein S17;

Homologs  Archaea  0/68 : Bacteria  877/915 : Eukaryota  30/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:105 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->105 2uxcQ PDBj 4e-56 100.0 %
:RPS:PDB   2->100 3d5aQ PDBj 4e-28 100.0 %
:RPS:SCOP  2->105 1fjgQ  b.40.4.5 * 7e-28 100.0 %
:HMM:SCOP  2->105 1fjgQ_ b.40.4.5 * 6.4e-32 47.1 %
:RPS:PFM   8->76 PF00366 * Ribosomal_S17 4e-16 60.9 %
:HMM:PFM   8->75 PF00366 * Ribosomal_S17 3.3e-34 63.2 68/69  
:BLT:SWISS 1->105 RS17_THETH 3e-56 100.0 %
:PROS 54->66|PS00056|RIBOSOMAL_S17

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81661.1 GT:GENE AAS81661.1 GT:PRODUCT SSU ribosomal protein S17P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1261938..1262255) GB:FROM 1261938 GB:TO 1262255 GB:DIRECTION - GB:PRODUCT SSU ribosomal protein S17P GB:PROTEIN_ID AAS81661.1 GB:DB_XREF GI:46197247 LENGTH 105 SQ:AASEQ MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA GT:EXON 1|1-105:0| SW:ID RS17_THETH SW:DE RecName: Full=30S ribosomal protein S17; SW:GN Name=rpsQ; Synonyms=rps17; SW:KW 3D-structure; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->105|RS17_THETH|3e-56|100.0|105/105| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 54->66|PS00056|RIBOSOMAL_S17|PDOC00055| BL:PDB:NREP 1 BL:PDB:REP 2->105|2uxcQ|4e-56|100.0|104/104| RP:PDB:NREP 1 RP:PDB:REP 2->100|3d5aQ|4e-28|100.0|99/99| RP:PFM:NREP 1 RP:PFM:REP 8->76|PF00366|4e-16|60.9|69/69|Ribosomal_S17| HM:PFM:NREP 1 HM:PFM:REP 8->75|PF00366|3.3e-34|63.2|68/69|Ribosomal_S17| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00366|IPR000266| GO:PFM GO:0005622|"GO:intracellular"|PF00366|IPR000266| GO:PFM GO:0005840|"GO:ribosome"|PF00366|IPR000266| GO:PFM GO:0006412|"GO:translation"|PF00366|IPR000266| RP:SCP:NREP 1 RP:SCP:REP 2->105|1fjgQ|7e-28|100.0|104/104|b.40.4.5| HM:SCP:REP 2->105|1fjgQ_|6.4e-32|47.1|104/104|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 944 OP:NHOMOORG 907 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111112111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111121111111111111111111111111111-11111111111112-1111111111111111111111111111111111111111---11111--111111111111111-1--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111-111111-1-------11111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111-1111111111111111111111111111111111-1111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111-1111111-111111----111111111111111111111- --------------------------------------------------------------------------------------22-11--1111111----11-1-------------------------------------------------------------------11-1G222223233-31-1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 99.0 SQ:SECSTR #cccEEEEEEEEcccccEEEEEEEEEEEcTTTccEEEEEEEEEEEcTTccccTTcEEEEEEEEEEETTEEEEEEEEEEcccHHHHHHHHHHHHHHHTTccccccc DISOP:02AL 86-89, 98-100, 102-105| PSIPRED cccEEEEEEEEEcccccEEEEEEEEEEEccEEcEEEEEEcEEEEEccccEEEcccEEEEEEcccccccEEEEEEEEEccccccHHHEEEEcccHHHHHHcccccc //