[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81662.1
DDBJ      :             50S ribosomal protein L29
Swiss-Prot:RL29_THET8   RecName: Full=50S ribosomal protein L29;

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.2.2
:72 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->72 3d5b2 PDBj 3e-23 100.0 %
:RPS:PDB   1->72 3d5b2 PDBj 6e-06 75.0 %
:RPS:SCOP  37->69 1vs6X1  a.2.2.1 * 2e-05 45.5 %
:HMM:SCOP  8->73 1r73A_ a.2.2.1 * 5.9e-14 43.9 %
:HMM:PFM   11->67 PF00831 * Ribosomal_L29 7.3e-24 52.6 57/58  
:BLT:SWISS 1->72 RL29_THET8 3e-23 100.0 %
:PROS 46->60|PS00579|RIBOSOMAL_L29
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81662.1 GT:GENE AAS81662.1 GT:PRODUCT 50S ribosomal protein L29 GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1262248..1262466) GB:FROM 1262248 GB:TO 1262466 GB:DIRECTION - GB:PRODUCT 50S ribosomal protein L29 GB:PROTEIN_ID AAS81662.1 GB:DB_XREF GI:46197248 LENGTH 72 SQ:AASEQ MKLSEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKIRDLKRQIARLLTVLNEKRRQNA GT:EXON 1|1-72:0| SW:ID RL29_THET8 SW:DE RecName: Full=50S ribosomal protein L29; SW:GN Name=rpmC; OrderedLocusNames=TTHA1684; SW:KW 3D-structure; Complete proteome; Direct protein sequencing;Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->72|RL29_THET8|3e-23|100.0|72/72| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 46->60|PS00579|RIBOSOMAL_L29|PDOC00501| SEG 19->36|veleklvrekkrelmelr| BL:PDB:NREP 1 BL:PDB:REP 1->72|3d5b2|3e-23|100.0|72/72| RP:PDB:NREP 1 RP:PDB:REP 1->72|3d5b2|6e-06|75.0|72/72| HM:PFM:NREP 1 HM:PFM:REP 11->67|PF00831|7.3e-24|52.6|57/58|Ribosomal_L29| RP:SCP:NREP 1 RP:SCP:REP 37->69|1vs6X1|2e-05|45.5|33/63|a.2.2.1| HM:SCP:REP 8->73|1r73A_|5.9e-14|43.9|66/0|a.2.2.1|1/1|Ribosomal protein L29 (L29p)| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 100.0 SQ:SECSTR cHHHHHHHHHHTTTTcTHHHHHHHHHHHHHHHHHHHHHHHHcTTccTTHHHHHHHHHHHHHHHHHHHHHHHc DISOP:02AL 1-10, 67-72| PSIPRED ccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccc //