[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81663.1
DDBJ      :             LSU ribosomal protein L16P
Swiss-Prot:RL16_THET2   RecName: Full=50S ribosomal protein L16;

Homologs  Archaea  0/68 : Bacteria  910/915 : Eukaryota  80/199 : Viruses  0/175   --->[See Alignment]
d.41.4
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->141 2jl6Q PDBj 4e-79 99.3 %
:RPS:PDB   1->134 3bboO PDBj 2e-44 56.0 %
:RPS:SCOP  1->135 1vs6M1  d.41.4.2 * 2e-45 57.5 %
:HMM:SCOP  3->134 2gyaK1 d.41.4.2 * 9.3e-56 64.1 %
:RPS:PFM   4->132 PF00252 * Ribosomal_L16 1e-31 57.8 %
:HMM:PFM   4->132 PF00252 * Ribosomal_L16 2.1e-54 61.2 129/133  
:BLT:SWISS 1->141 RL16_THET2 5e-79 100.0 %
:REPEAT 2|4->53|73->121

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81663.1 GT:GENE AAS81663.1 GT:PRODUCT LSU ribosomal protein L16P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1262453..1262878) GB:FROM 1262453 GB:TO 1262878 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L16P GB:PROTEIN_ID AAS81663.1 GB:DB_XREF GI:46197249 LENGTH 141 SQ:AASEQ MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDFGLVALEPAWITAQQIEAARVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPGRVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ GT:EXON 1|1-141:0| SW:ID RL16_THET2 SW:DE RecName: Full=50S ribosomal protein L16; SW:GN Name=rplP; OrderedLocusNames=TT_C1321; SW:KW 3D-structure; Complete proteome; Ribonucleoprotein; Ribosomal protein;RNA-binding; rRNA-binding; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->141|RL16_THET2|5e-79|100.0|141/141| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| NREPEAT 1 REPEAT 2|4->53|73->121| BL:PDB:NREP 1 BL:PDB:REP 1->141|2jl6Q|4e-79|99.3|141/141| RP:PDB:NREP 1 RP:PDB:REP 1->134|3bboO|2e-44|56.0|134/135| RP:PFM:NREP 1 RP:PFM:REP 4->132|PF00252|1e-31|57.8|128/130|Ribosomal_L16| HM:PFM:NREP 1 HM:PFM:REP 4->132|PF00252|2.1e-54|61.2|129/133|Ribosomal_L16| GO:PFM:NREP 3 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00252|IPR016180| GO:PFM GO:0005840|"GO:ribosome"|PF00252|IPR016180| GO:PFM GO:0006412|"GO:translation"|PF00252|IPR016180| RP:SCP:NREP 1 RP:SCP:REP 1->135|1vs6M1|2e-45|57.5|134/136|d.41.4.2| HM:SCP:REP 3->134|2gyaK1|9.3e-56|64.1|131/0|d.41.4.2|1/1|Ribosomal protein L16p/L10e| OP:NHOMO 1004 OP:NHOMOORG 990 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 -1----------111--11-111111111-----11-111-11---------------1111111111--1111-1111111111111-121-111111-1-1112---------3-1-------------------1---------------1-1-----------------11111----1--12-4113------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 100.0 SQ:SECSTR cccccccccccccccccccTTccccccccccEEEEEcccccccHHHHHHHHHHHHHTTccccccccccccccccccccccccccccccccccccccccTTcEEEEEccccTTHHHHHHHHHHHHccccEEEEccTTccccc DISOP:02AL 137-141| PSIPRED cccccccccccccccccccccccccEEEEccEEEEEEcccEEcHHHHHHHHHHHHHHcccccEEEEEEcccccEEEcccccccccccccccEEEEEEEccEEEEEEEcccHHHHHHHHHHHHHHccccEEEEEEccccccc //