[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81666.1
DDBJ      :             SSU ribosomal protein S19P
Swiss-Prot:RS19_THETH   RecName: Full=30S ribosomal protein S19;

Homologs  Archaea  45/68 : Bacteria  901/915 : Eukaryota  76/199 : Viruses  0/175   --->[See Alignment]
d.28.1
:93 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->88 1ibmS PDBj 1e-48 100.0 %
:RPS:PDB   1->92 3bbnS PDBj 1e-33 59.8 %
:RPS:SCOP  2->85 1fjgS  d.28.1.1 * 3e-33 100.0 %
:HMM:SCOP  2->85 1fjgS_ d.28.1.1 * 1.8e-35 65.5 %
:RPS:PFM   3->83 PF00203 * Ribosomal_S19 2e-27 76.5 %
:HMM:PFM   3->83 PF00203 * Ribosomal_S19 2.5e-42 70.4 81/81  
:BLT:SWISS 1->93 RS19_THETH 1e-51 100.0 %
:PROS 53->77|PS00323|RIBOSOMAL_S19

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81666.1 GT:GENE AAS81666.1 GT:PRODUCT SSU ribosomal protein S19P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1263935..1264216) GB:FROM 1263935 GB:TO 1264216 GB:DIRECTION - GB:PRODUCT SSU ribosomal protein S19P GB:PROTEIN_ID AAS81666.1 GB:DB_XREF GI:46197252 LENGTH 93 SQ:AASEQ MPRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYITENMVGHKLGEFAPTRTYRGHGKEAKATKKK GT:EXON 1|1-93:0| SW:ID RS19_THETH SW:DE RecName: Full=30S ribosomal protein S19; SW:GN Name=rpsS; Synonyms=rps19; SW:KW 3D-structure; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->93|RS19_THETH|1e-51|100.0|93/93| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 53->77|PS00323|RIBOSOMAL_S19|PDOC00288| BL:PDB:NREP 1 BL:PDB:REP 2->88|1ibmS|1e-48|100.0|87/87| RP:PDB:NREP 1 RP:PDB:REP 1->92|3bbnS|1e-33|59.8|92/92| RP:PFM:NREP 1 RP:PFM:REP 3->83|PF00203|2e-27|76.5|81/81|Ribosomal_S19| HM:PFM:NREP 1 HM:PFM:REP 3->83|PF00203|2.5e-42|70.4|81/81|Ribosomal_S19| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00203|IPR002222| GO:PFM GO:0005622|"GO:intracellular"|PF00203|IPR002222| GO:PFM GO:0005840|"GO:ribosome"|PF00203|IPR002222| GO:PFM GO:0006412|"GO:translation"|PF00203|IPR002222| RP:SCP:NREP 1 RP:SCP:REP 2->85|1fjgS|3e-33|100.0|84/84|d.28.1.1| HM:SCP:REP 2->85|1fjgS_|1.8e-35|65.5|84/84|d.28.1.1|1/1|Ribosomal protein S19| OP:NHOMO 1044 OP:NHOMOORG 1022 OP:PATTERN 11111111111111111111111---------11-111-111-------111111111111---11-- 1111111-11111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111-111111111111111-111111111111-1111111111111111111111111111111111111111111111111-11111-11111111111111111111-111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 11-----11---11-11--1-1-----1-----111-111111---11---1-1111-1-1-11-1111111--111111-2221211-1111-1411111-1111--------------------------------------------------------------------1111-------11-A112------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 92 STR:RPRED 98.9 SQ:SECSTR ccccccccccccHHHHHHHHTTTTTTccccEEEccccccccTTcTTccEEEEccccEEEEcccccccccccTTTcccccccccccccccccc# DISOP:02AL 20-28, 81-93| PSIPRED ccccccccccccHHHHHHHHHHHHcccccEEEEEEccccccHHHcccEEEEccccEEEEEEEccccccEEcccEEEccccccccccccccccc //