[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81670.1
DDBJ      :             LSU ribosomal protein L3P
Swiss-Prot:RL3_THETH    RecName: Full=50S ribosomal protein L3;

Homologs  Archaea  4/68 : Bacteria  907/915 : Eukaryota  180/199 : Viruses  0/175   --->[See Alignment]
b.43.3
:206 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->206 2hguE PDBj e-121 100.0 %
:RPS:PDB   56->203 3bboF PDBj 3e-10 42.2 %
:RPS:SCOP  1->204 1vs6D1  b.43.3.2 * 1e-72 53.9 %
:HMM:SCOP  1->207 1ffkB_ b.43.3.2 * 2.3e-79 55.8 %
:RPS:PFM   8->199 PF00297 * Ribosomal_L3 3e-38 53.9 %
:HMM:PFM   8->199 PF00297 * Ribosomal_L3 4.4e-43 42.1 190/263  
:BLT:SWISS 1->206 RL3_THETH e-120 100.0 %
:PROS 96->119|PS00474|RIBOSOMAL_L3

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81670.1 GT:GENE AAS81670.1 GT:PRODUCT LSU ribosomal protein L3P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1266023..1266643) GB:FROM 1266023 GB:TO 1266643 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L3P GB:PROTEIN_ID AAS81670.1 GB:DB_XREF GI:46197256 LENGTH 206 SQ:AASEQ MKGILGVKVGMTRIFRDDRAVPVTVILAGPCPVVQRRTPEKDGYTAVQLGFLPQNPKRVNRPLKGHFAKAGVEPVRILREIRDFNPEGDTVTVEIFKPGERVDVTGTSKGRGFAGVMKRWNFAGGPDSHGAHKIHRHPGSIGNRKTPGRVYKGKKMAGHYGAERVTVMNLEVVDVIPEENLLLVKGAVPGPNGGLVIVRETKKAAK GT:EXON 1|1-206:0| SW:ID RL3_THETH SW:DE RecName: Full=50S ribosomal protein L3; SW:GN Name=rplC; Synonyms=rpl3; SW:KW 3D-structure; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->206|RL3_THETH|e-120|100.0|206/206| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 96->119|PS00474|RIBOSOMAL_L3|PDOC00385| BL:PDB:NREP 1 BL:PDB:REP 1->206|2hguE|e-121|100.0|206/206| RP:PDB:NREP 1 RP:PDB:REP 56->203|3bboF|3e-10|42.2|147/154| RP:PFM:NREP 1 RP:PFM:REP 8->199|PF00297|3e-38|53.9|191/196|Ribosomal_L3| HM:PFM:NREP 1 HM:PFM:REP 8->199|PF00297|4.4e-43|42.1|190/263|Ribosomal_L3| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00297|IPR000597| GO:PFM GO:0005622|"GO:intracellular"|PF00297|IPR000597| GO:PFM GO:0005840|"GO:ribosome"|PF00297|IPR000597| GO:PFM GO:0006412|"GO:translation"|PF00297|IPR000597| RP:SCP:NREP 1 RP:SCP:REP 1->204|1vs6D1|1e-72|53.9|204/209|b.43.3.2| HM:SCP:REP 1->207|1ffkB_|2.3e-79|55.8|206/337|b.43.3.2|1/1|Translation proteins| OP:NHOMO 1163 OP:NHOMOORG 1091 OP:PATTERN -----------------------------1----1--1---------------------------1-- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111-1111111111111111111111111111112111111211111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 22--111-41--1111111111111111111111111111111111111111111111111-111111-1111111111111111111-12111111111111111-1212221121--1111-11111241-1121-1-1-111111111112-1111-111111-111111222122S2222232431221131111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 206 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEEccEEccccEEccEEEEcccccccEEEccccccccEEEEEcccccccccccHHHHTTcccccccccccccccccccccTcccccccccccccccccccccccccccccccccccccccccccccTTTcccccccccccTTTTTTccccccccccccccccccEEEEETTTTEEEEcccccccccccccccccccccc DISOP:02AL 124-137, 204-206| PSIPRED cEEEEEEEEcccEEEEcccEEEEEEEEEccEEEEEEEcccccccEEEEEEEEEEccEEccHHHHHHHHHHccccccEEEEEEEccccccEEEEEEEccccEEEEEEEEccccEEccEEEcccccccccccccccccccEEccccccccEEEcccccccccccEEEEEEEEEEEEEcccccEEEEEcccccccccEEEEEccccccc //