[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81671.1
DDBJ      :             SSU ribosomal protein S10P
Swiss-Prot:RS10_THETH   RecName: Full=30S ribosomal protein S10;

Homologs  Archaea  45/68 : Bacteria  900/915 : Eukaryota  86/199 : Viruses  0/175   --->[See Alignment]
d.58.15
:105 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->100 2j00J PDBj 3e-53 100.0 %
:RPS:PDB   3->99 3bbnJ PDBj 2e-30 51.5 %
:RPS:SCOP  3->100 1fjgJ  d.58.15.1 * 1e-31 100.0 %
:HMM:SCOP  3->99 1fjgJ_ d.58.15.1 * 1.4e-32 52.6 %
:RPS:PFM   4->99 PF00338 * Ribosomal_S10 9e-27 62.5 %
:HMM:PFM   4->99 PF00338 * Ribosomal_S10 1.1e-39 54.2 96/97  
:BLT:SWISS 1->105 RS10_THETH 2e-57 100.0 %
:PROS 27->42|PS00361|RIBOSOMAL_S10

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81671.1 GT:GENE AAS81671.1 GT:PRODUCT SSU ribosomal protein S10P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1266640..1266957) GB:FROM 1266640 GB:TO 1266957 GB:DIRECTION - GB:PRODUCT SSU ribosomal protein S10P GB:PROTEIN_ID AAS81671.1 GB:DB_XREF GI:46197257 LENGTH 105 SQ:AASEQ MPKIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKTVGGGR GT:EXON 1|1-105:0| SW:ID RS10_THETH SW:DE RecName: Full=30S ribosomal protein S10; SW:GN Name=rpsJ; Synonyms=rps10; SW:KW 3D-structure; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->105|RS10_THETH|2e-57|100.0|105/105| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 27->42|PS00361|RIBOSOMAL_S10|PDOC00312| BL:PDB:NREP 1 BL:PDB:REP 3->100|2j00J|3e-53|100.0|98/98| RP:PDB:NREP 1 RP:PDB:REP 3->99|3bbnJ|2e-30|51.5|97/99| RP:PFM:NREP 1 RP:PFM:REP 4->99|PF00338|9e-27|62.5|96/97|Ribosomal_S10| HM:PFM:NREP 1 HM:PFM:REP 4->99|PF00338|1.1e-39|54.2|96/97|Ribosomal_S10| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00338|IPR001848| GO:PFM GO:0005622|"GO:intracellular"|PF00338|IPR001848| GO:PFM GO:0005840|"GO:ribosome"|PF00338|IPR001848| GO:PFM GO:0006412|"GO:translation"|PF00338|IPR001848| RP:SCP:NREP 1 RP:SCP:REP 3->100|1fjgJ|1e-31|100.0|98/98|d.58.15.1| HM:SCP:REP 3->99|1fjgJ_|1.4e-32|52.6|97/0|d.58.15.1|1/1|Ribosomal protein S10| OP:NHOMO 1079 OP:NHOMOORG 1031 OP:PATTERN 11-1---1-------1111-1-111111-111111111111111111-1-----11111111111--- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111-111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111121111111111111111111111111111-111111111111-2-111111111111111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111-111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 -----11-------1--1------1---------11--------------------------1--1111-11-1-111111-----11-1---1--------1322-11-112111111-11111311-111-111----11112-----1--111111---12------4---21221F222116134-12------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 98 STR:RPRED 93.3 SQ:SECSTR ##ccEEEEEEccHHHHHHHTTHHHHTTTTTcccEEEEEEcccEEEEEcccccccccccccccEEEEEEEEEEEEccccHHHHHHHTTcccccccEEEEEc##### DISOP:02AL 104-105| PSIPRED ccEEEEEEEEEcHHHHHHHHHHHHHHHHHccccEEEEEcccccEEEEEEEcccccccccHHHHEEEEEEEEEEEEcccHHHHHHHHccccccccEEEEEEEEccc //