[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81675.1
DDBJ      :             SSU ribosomal protein S12P
Swiss-Prot:RS12_THETH   RecName: Full=30S ribosomal protein S12;

Homologs  Archaea  9/68 : Bacteria  904/915 : Eukaryota  157/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:134 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->121 2j00L PDBj 4e-57 100.0 %
:RPS:PDB   3->121 3bbnL PDBj 2e-44 67.2 %
:RPS:SCOP  4->121 1fjgL  b.40.4.5 * 3e-46 89.8 %
:HMM:SCOP  4->128 1fjgL_ b.40.4.5 * 1.1e-53 71.2 %
:RPS:PFM   5->120 PF00164 * Ribosomal_S12 9e-37 75.9 %
:HMM:PFM   4->125 PF00164 * Ribosomal_S12 4e-60 70.5 122/122  
:BLT:SWISS 3->121 RS12_THETH 7e-57 99.2 %
:PROS 45->52|PS00055|RIBOSOMAL_S12
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81675.1 GT:GENE AAS81675.1 GT:PRODUCT SSU ribosomal protein S12P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1270800..1271204) GB:FROM 1270800 GB:TO 1271204 GB:DIRECTION - GB:PRODUCT SSU ribosomal protein S12P GB:PROTEIN_ID AAS81675.1 GB:DB_XREF GI:46197261 LENGTH 134 SQ:AASEQ MALPTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAAKTAAKK GT:EXON 1|1-134:0| SW:ID RS12_THETH SW:DE RecName: Full=30S ribosomal protein S12; SW:GN Name=rpsL; Synonyms=rps12; SW:KW 3D-structure; Antibiotic resistance; Direct protein sequencing;Ribonucleoprotein; Ribosomal protein; RNA-binding; rRNA-binding;tRNA-binding. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 3->121|RS12_THETH|7e-57|99.2|119/132| GO:SWS:NREP 6 GO:SWS GO:0046677|"GO:response to antibiotic"|Antibiotic resistance| GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 45->52|PS00055|RIBOSOMAL_S12|PDOC00054| SEG 32->43|rrgvctvvrtvt| SEG 122->133|kkpkeaaktaak| BL:PDB:NREP 1 BL:PDB:REP 4->121|2j00L|4e-57|100.0|118/124| RP:PDB:NREP 1 RP:PDB:REP 3->121|3bbnL|2e-44|67.2|119/123| RP:PFM:NREP 1 RP:PFM:REP 5->120|PF00164|9e-37|75.9|116/122|Ribosomal_S12| HM:PFM:NREP 1 HM:PFM:REP 4->125|PF00164|4e-60|70.5|122/122|Ribosomal_S12| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00164|IPR006032| GO:PFM GO:0005622|"GO:intracellular"|PF00164|IPR006032| GO:PFM GO:0005840|"GO:ribosome"|PF00164|IPR006032| GO:PFM GO:0006412|"GO:translation"|PF00164|IPR006032| RP:SCP:NREP 1 RP:SCP:REP 4->121|1fjgL|3e-46|89.8|118/125|b.40.4.5| HM:SCP:REP 4->128|1fjgL_|1.1e-53|71.2|125/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1098 OP:NHOMOORG 1070 OP:PATTERN ---------------1-------------------------------------11111111------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111112-11111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111211111111111111111111111111111111111111111111111111111111111111111111111--111111111111111-11-111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 11------1---11111111111111111----11111-111111111111111111111-111111111111111111111111121-11111111111111111-1--21211--1111-1111121323-111111111111-11-1111111111211111111-111121211--------3-8112------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 119 STR:RPRED 88.8 SQ:SECSTR ##cccTTHHHHTcccccccccccccTTTcccEEEEEEEEEEEcccccccccEEEEEEEETTccEEEEEcccccccccTTcEEEEccccccccTTccEEccTTcTTccccTTcccccccTTc############# DISOP:02AL 12-25, 110-134| PSIPRED cccHHHHHHHHccccccccccccccccccccccEEEEEEEEEcccccccccccEEEEEEcccEEEEEEEcccccccccccEEEEcccccccccccEEEEEEccHHHccccccccccccccccccHHHHcccccc //