[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81679.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:94 amino acids
:PSIPRED
:HMM:PFM   60->76 PF07589 * VPEP 0.00012 47.1 17/25  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81679.1 GT:GENE AAS81679.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1273273..1273557 GB:FROM 1273273 GB:TO 1273557 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81679.1 GB:DB_XREF GI:46197265 LENGTH 94 SQ:AASEQ MEKVLLVLGLLVMVYNLLYGLRLKRAVPGGVIGERSGQMLFLIAFFALAYLGVLLLTWNEPSSLLLFLLSLILLLGAVFVYLVLRLVDAIVASL GT:EXON 1|1-94:0| TM:NTM 3 TM:REGION 2->22| TM:REGION 35->56| TM:REGION 67->89| SEG 4->21|vllvlgllvmvynllygl| SEG 40->49|lfliaffala| SEG 62->75|sslllfllslilll| HM:PFM:NREP 1 HM:PFM:REP 60->76|PF07589|0.00012|47.1|17/25|VPEP| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //