Thermus thermophilus HB27 (tthe0)
Gene : AAS81680.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:132 amino acids
:HMM:PFM   21->65 PF01978 * TrmB 4.5e-05 33.3 45/68  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81680.1 GT:GENE AAS81680.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1273560..1273958 GB:FROM 1273560 GB:TO 1273958 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81680.1 GB:DB_XREF GI:46197266 LENGTH 132 SQ:AASEQ MVFRRNPTPPETEWKPTPEEWRVYALCDGRRTEEEVVRESGLGEEAYAILAALLKRGLILPVEGPKELCQRLVELLKSRLGPKAEPFVKRLEECPSRESLEEEALRVALKVKLTLDKKAGEELEKAVRTLFR GT:EXON 1|1-132:0| SEG 7->21|ptppetewkptpeew| SEG 90->103|rleecpsresleee| HM:PFM:NREP 1 HM:PFM:REP 21->65|PF01978|4.5e-05|33.3|45/68|TrmB| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 96-98| PSIPRED cccccccccccccccccHHHcEEEEEEcccccHHHHHHHccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHccccccHHHHHHHHHHHHHEEEcHHccHHHHHHHHHHcc //