[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81692.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:129 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   42->89 PF02378 * PTS_EIIC 0.00048 27.5 40/321  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81692.1 GT:GENE AAS81692.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1283454..1283843) GB:FROM 1283454 GB:TO 1283843 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81692.1 GB:DB_XREF GI:46197278 LENGTH 129 SQ:AASEQ MYEAVLALHNLVRWLVLFFGLWALFRPEPRPGALFAHALTLQVVLGVILAFVSPYFQGLLAAFGEAMRAGGEARFFAAEHWVGGLVALGLAHAGLARARRGKPGARLLFGLALGVLLLSVPWFRPLVRL GT:EXON 1|1-129:0| TM:NTM 4 TM:REGION 4->26| TM:REGION 39->61| TM:REGION 75->96| TM:REGION 105->127| SEG 82->101|vgglvalglahaglararrg| SEG 104->118|garllfglalgvlll| HM:PFM:NREP 1 HM:PFM:REP 42->89|PF02378|0.00048|27.5|40/321|PTS_EIIC| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 98-100| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcc //