[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81693.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  27/68 : Bacteria  143/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.273.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->129 2cu5A PDBj 2e-62 97.7 %
:RPS:PDB   1->129 2cu5A PDBj 6e-38 86.8 %
:RPS:SCOP  6->129 1vmjA  d.273.1.1 * 4e-28 29.3 %
:HMM:SCOP  3->131 1xbfA_ d.273.1.1 * 1.2e-34 46.1 %
:RPS:PFM   17->129 PF01894 * UPF0047 8e-10 38.9 %
:HMM:PFM   18->128 PF01894 * UPF0047 6.2e-35 47.3 110/118  
:BLT:SWISS 11->129 YUGU_BACSU 3e-21 38.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81693.1 GT:GENE AAS81693.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1283895..1284284 GB:FROM 1283895 GB:TO 1284284 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS81693.1 GB:DB_XREF GI:46197279 LENGTH 129 SQ:AASEQ MEGVVRLEVPTPEEGFVNITRKVEEALSGHTGLVYLFVPHTTCGLTVQEGADPTVAQDLLSRLAELAPRHRPQDRHLEGNSHAHLKSLLTGVHLLLLAEKGRLRLGRWQQVFLVEFDGPRVREVWVRLL GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 11->129|YUGU_BACSU|3e-21|38.7|119/132| SEG 94->107|llllaekgrlrlgr| BL:PDB:NREP 1 BL:PDB:REP 1->129|2cu5A|2e-62|97.7|129/129| RP:PDB:NREP 1 RP:PDB:REP 1->129|2cu5A|6e-38|86.8|129/129| RP:PFM:NREP 1 RP:PFM:REP 17->129|PF01894|8e-10|38.9|113/120|UPF0047| HM:PFM:NREP 1 HM:PFM:REP 18->128|PF01894|6.2e-35|47.3|110/118|UPF0047| RP:SCP:NREP 1 RP:SCP:REP 6->129|1vmjA|4e-28|29.3|123/139|d.273.1.1| HM:SCP:REP 3->131|1xbfA_|1.2e-34|46.1|128/131|d.273.1.1|1/1|YjbQ-like| OP:NHOMO 176 OP:NHOMOORG 172 OP:PATTERN ----1111-------1--111111---11--1---11-11111----1------111--1-----1-- --1------------------------------------------------------------------------------111121111---------------------------------------------------111-11-----------1--------111----------------1111--11---------------111111---111-1---------1------------------------------------------------------------------------------------------1--11---------11-11-111--1------1111-21111111111---1----1--------11---11111------------11-11-11-----------------1------------------------------------------------------------1-------------------------------------------------------------------------1-111-111111111-1111111111111--11----------------------12111-------1-1--------------------------1----------------------------------------------------------------------------------------------------11-11-1------------------------1---------------------------------111111-111----------------11------------------------------------------11111111111-- ----------------------------------------------------------------------------------------------------1-------1------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 100.0 SQ:SECSTR cTTcEEEEEEEcccEEEEcHHHHHHTcTTccEEEEEEcccccEEEEEEccccHHHHHHHHHHHHHHcccccTTcccTTccHHHHHHHHHHccEEEEEEETTEEcccTTcEEEEEEccccEEEEEEEEEc DISOP:02AL 1-2| PSIPRED ccEEEEEEEEccccEEEEccHHHHHHHHHcccEEEEEEccccEEEEEEEcccccHHHHHHHHHHHHccccccEEEccccccHHHHHHHHHccEEEEEEEccEEccccEEEEEEEEcccccccEEEEEEc //