[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81698.1
DDBJ      :             heavy metal binding protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  147/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.58.17
:66 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->66 2roeA PDBj 1e-32 98.5 %
:RPS:PDB   4->66 2aj0A PDBj 1e-12 22.2 %
:RPS:SCOP  2->63 1sb6A  d.58.17.1 * 4e-15 25.8 %
:HMM:SCOP  2->66 1mwzA_ d.58.17.1 * 7.1e-19 47.7 %
:RPS:PFM   4->60 PF00403 * HMA 2e-07 52.6 %
:HMM:PFM   4->61 PF00403 * HMA 1.5e-20 43.1 58/62  
:BLT:SWISS 8->65 COPA_ECOLI 4e-12 51.7 %
:PROS 6->35|PS01047|HMA_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81698.1 GT:GENE AAS81698.1 GT:PRODUCT heavy metal binding protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1290751..1290951 GB:FROM 1290751 GB:TO 1290951 GB:DIRECTION + GB:PRODUCT heavy metal binding protein GB:PROTEIN_ID AAS81698.1 GB:DB_XREF GI:46197284 LENGTH 66 SQ:AASEQ MLKLKVEGMTCNHCVMAVTKALKKVPGVEKVKVSLEKGEALVEGTADPKALVQAVEEEGYKAEVLA GT:EXON 1|1-66:0| BL:SWS:NREP 1 BL:SWS:REP 8->65|COPA_ECOLI|4e-12|51.7|58/834| PROS 6->35|PS01047|HMA_1|PDOC00804| BL:PDB:NREP 1 BL:PDB:REP 1->66|2roeA|1e-32|98.5|66/66| RP:PDB:NREP 1 RP:PDB:REP 4->66|2aj0A|1e-12|22.2|63/71| RP:PFM:NREP 1 RP:PFM:REP 4->60|PF00403|2e-07|52.6|57/62|HMA| HM:PFM:NREP 1 HM:PFM:REP 4->61|PF00403|1.5e-20|43.1|58/62|HMA| GO:PFM:NREP 2 GO:PFM GO:0030001|"GO:metal ion transport"|PF00403|IPR006121| GO:PFM GO:0046872|"GO:metal ion binding"|PF00403|IPR006121| RP:SCP:NREP 1 RP:SCP:REP 2->63|1sb6A|4e-15|25.8|62/64|d.58.17.1| HM:SCP:REP 2->66|1mwzA_|7.1e-19|47.7|65/0|d.58.17.1|1/1|HMA, heavy metal-associated domain| OP:NHOMO 175 OP:NHOMOORG 153 OP:PATTERN ------------------------1----11-------------------1-1--------------- ---------------------------------111--21-------1------------------------------1-----1---------------------------------------------------------------------------------1----------------12111---1-------------------11-----1-1----111111---------------------------------------------111----------------------------------------------------1111-1-------------11----11-1--------------------------------1---------------1------1--1---------------------------------------------------------------------------------1---------------11-----------1-1---------1-1--------1-------------2---------------111-------------------------------------------22----1-----------------------------11-------1-111111111111111-11111111-111111111111111111212122222221211121111111-----------------1---------1--1-222-11---------------------1121---------3-----------------111111----1---1-----------------------------------------------------------------1-- --------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 66 STR:RPRED 100.0 SQ:SECSTR cEEEEEEccccHHHHHHHHHHHHHcTTEEEEEEccccEEEEEEEcHHHHHHHHTTTTcEEEccccc PSIPRED cEEEEEccccHHHHHHHHHHHHHccccEEEEEEEccccEEEEEEcccHHHHHHHHHHcccccEEcc //