[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81706.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:83 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  9->62 1khtA  c.37.1.1 * 2e-05 20.8 %
:HMM:PFM   14->46 PF03990 * DUF348 0.00042 47.6 21/43  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81706.1 GT:GENE AAS81706.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1297046..1297297 GB:FROM 1297046 GB:TO 1297297 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81706.1 GB:DB_XREF GI:46197292 LENGTH 83 SQ:AASEQ MGSPEYVLTQHAREVLEKRGIPLEWIERALAFPETVEKDRVDPSLEHRLVRIPERGKVLRVVVNPKPHPMRVVTVFLDQRVVL GT:EXON 1|1-83:0| HM:PFM:NREP 1 HM:PFM:REP 14->46|PF03990|0.00042|47.6|21/43|DUF348| RP:SCP:NREP 1 RP:SCP:REP 9->62|1khtA|2e-05|20.8|53/190|c.37.1.1| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -----------------------------------------------1-------------------- --------------------------------------------------------------------------------------------------------------------------------------------1-------------1-------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccccEEHHHHHHHHHHccccHHHHHHHHcccHHHHHccccHHHHHHHHHHHHcccEEEEEEccccccEEEEEEEEccEEcc //