[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81707.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:70 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->47 PF10049 * DUF2283 2e-10 59.6 %
:HMM:PFM   1->49 PF10049 * DUF2283 2.6e-23 57.1 49/50  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81707.1 GT:GENE AAS81707.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1297294..1297506 GB:FROM 1297294 GB:TO 1297506 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS81707.1 GB:DB_XREF GI:46197293 LENGTH 70 SQ:AASEQ MRLKIDREADALYLTLTEGPASRSEEVAPGIIVDYDEQGRLVGVEVLYLSQRAPEAELQRFLFETVPSER GT:EXON 1|1-70:0| RP:PFM:NREP 1 RP:PFM:REP 1->47|PF10049|2e-10|59.6|47/50|DUF2283| HM:PFM:NREP 1 HM:PFM:REP 1->49|PF10049|2.6e-23|57.1|49/50|DUF2283| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN 1----------------------------------------------1-------------------- ---------------------------------------------------------------------------------------------------------------------------------11--1------1-----------1---------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------11---------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 68-70| PSIPRED cEEEEccccEEEEEEEcccccccccccccccEEEEcccccEEEEEEEcccccccHHHHHHHHHHcccccc //