[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81725.1
DDBJ      :             hypothetical protein/cluster function: phosphoribosylformylglycinamidine synthase
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.208.1
:139 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   7->139 1jw3A PDBj 3e-19 33.8 %
:RPS:SCOP  6->139 1jw3A  d.208.1.1 * 6e-41 33.6 %
:HMM:SCOP  1->139 1jw3A_ d.208.1.1 * 5.3e-38 37.4 %
:RPS:PFM   6->139 PF01951 * Archease 1e-22 42.4 %
:HMM:PFM   5->139 PF01951 * Archease 1e-36 34.3 134/137  
:BLT:SWISS 6->139 Y1251_METBF 3e-20 36.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81725.1 GT:GENE AAS81725.1 GT:PRODUCT hypothetical protein/cluster function: phosphoribosylformylglycinamidine synthase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1312497..1312916 GB:FROM 1312497 GB:TO 1312916 GB:DIRECTION + GB:PRODUCT hypothetical protein/cluster function: phosphoribosylformylglycinamidine synthase GB:PROTEIN_ID AAS81725.1 GB:DB_XREF GI:46197311 LENGTH 139 SQ:AASEQ MVVRPLDHTADVGFALEAQNLEELFQAALKGLLDVMFTAPPQGGRKRRRLRLFAEDLETLLVRFLNELIYLIQTKGFVPGRARIRVEEEEGGYRLIATLFGEPFQEGLGFQGEVKSATFHGLSVRKEDDRWKAQVILDV GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 6->139|Y1251_METBF|3e-20|36.6|134/146| BL:PDB:NREP 1 BL:PDB:REP 7->139|1jw3A|3e-19|33.8|133/140| RP:PFM:NREP 1 RP:PFM:REP 6->139|PF01951|1e-22|42.4|132/137|Archease| HM:PFM:NREP 1 HM:PFM:REP 5->139|PF01951|1e-36|34.3|134/137|Archease| RP:SCP:NREP 1 RP:SCP:REP 6->139|1jw3A|6e-41|33.6|134/140|d.208.1.1| HM:SCP:REP 1->139|1jw3A_|5.3e-38|37.4|139/140|d.208.1.1|1/1|MTH1598-like| OP:NHOMO 41 OP:NHOMOORG 41 OP:PATTERN 11---------------111111------1----11--1111111-1---11111-1-1-1---1-1- ----------------------------------------------------------------------------------1----------------------------------------------------------111------------------------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------1--------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 95.7 SQ:SECSTR ######ccccEEEEEEEccccHHHHHHHHHHHHHHHcccTTcccccEEEEEEEEcccHHHHHHHHHHHHHHHHHTcccccccEEEEEEccccEEEEEEEEcccccTTcccccccccccccccEEEEETTEEEEEEEEEc PSIPRED cccEEccccccEEEEEEEccHHHHHHHHHHHHHccEEcccccccEEEEEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEEEEEEcccccEEEEEEEEEEEcccccccccEEEEEEEcccEEEEcccEEEEEEEEEc //