[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81728.1
DDBJ      :             S1 domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  355/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->92 1sroA PDBj 6e-13 45.9 %
:RPS:PDB   36->93 3bzcA PDBj 2e-11 36.2 %
:RPS:SCOP  19->92 1sroA  b.40.4.5 * 1e-14 45.9 %
:HMM:SCOP  20->97 1go3E1 b.40.4.5 * 1.7e-20 46.8 %
:RPS:PFM   36->84 PF00575 * S1 5e-07 46.9 %
:HMM:PFM   20->91 PF00575 * S1 5e-18 40.3 72/74  
:BLT:SWISS 19->93 PNP_PSEA6 1e-14 48.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81728.1 GT:GENE AAS81728.1 GT:PRODUCT S1 domain protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1314284..1314712) GB:FROM 1314284 GB:TO 1314712 GB:DIRECTION - GB:PRODUCT S1 domain protein GB:PROTEIN_ID AAS81728.1 GB:DB_XREF GI:46197314 LENGTH 142 SQ:AASEQ MWYSGGTAGGFRARRRNVELEAGTVVEGRVVRVVSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDLTPAPEGGAPPPRPRRLPKQSPEFENKLKSFLRGTGGFGGKGKKGGRKKR GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 19->93|PNP_PSEA6|1e-14|48.0|75/703| SEG 5->16|ggtaggfrarrr| SEG 25->34|vvegrvvrvv| SEG 95->110|papeggappprprrlp| SEG 125->141|rgtggfggkgkkggrkk| BL:PDB:NREP 1 BL:PDB:REP 19->92|1sroA|6e-13|45.9|74/76| RP:PDB:NREP 1 RP:PDB:REP 36->93|3bzcA|2e-11|36.2|58/730| RP:PFM:NREP 1 RP:PFM:REP 36->84|PF00575|5e-07|46.9|49/74|S1| HM:PFM:NREP 1 HM:PFM:REP 20->91|PF00575|5e-18|40.3|72/74|S1| GO:PFM:NREP 1 GO:PFM GO:0003723|"GO:RNA binding"|PF00575|IPR003029| RP:SCP:NREP 1 RP:SCP:REP 19->92|1sroA|1e-14|45.9|74/76|b.40.4.5| HM:SCP:REP 20->97|1go3E1|1.7e-20|46.8|77/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 394 OP:NHOMOORG 361 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------1---111----------------------------------------------------------------------------------------1----------------11111----1111111111111111111111111112221--333333--111222222222121212221---11----------------------------------------------------------------141---------1-11111----111111111-11-1211--11111------111-11--1-------------------------11-11-1----------------------------------------------------------------------------------------1----11------11-----1--11-1111111111111111111111--1111111111111111----1-------------1-1---------1--------------------------111-1111111111---1--1111111111111-1111-------11111111111111111-1111111111111111111111111111111--1---111111111111111-111111111111---111111-1--11111111111-1111111111111111111111111111111111-11---------11--1111111--11--111111111111------1111-------------------------------------11--11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--1--1--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 71.1 SQ:SECSTR #################HcccTTcEEEEEEEEEETTEEEEEcccccEEEEETTTccccccccHHHHccTTccccccEEEEETTTEEEEcccccEcccTTTccccEEETTEEEcTTTcc######################## DISOP:02AL 3-7, 93-142| PSIPRED ccccccHHHHHHHHHHHcccccccEEEEEEEEEEccEEEEEEcccccEEEEEEEccccccccHHHEEccccEEEEEEEEEccccEEEEEEEEcccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccc //