[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81734.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:268 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81734.1 GT:GENE AAS81734.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1319457..1320263) GB:FROM 1319457 GB:TO 1320263 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81734.1 GB:DB_XREF GI:46197320 LENGTH 268 SQ:AASEQ MQRWSALFLLLGLAQAQGFFGLGAVDGNVFGFGQAFPAGLWWRVGVDHNLEGSAYLYLRRGGVVDPLLGALGLGFPGAYYLGLGVEGGPSGARPSGLLGLEAFLGEGFAIFLEGMGPVYIAGGAHFGIGLRYYPSGREAFTPLLDPERRFRLYVPIPTGRPVVTALAYEGEGYALWLGGWGFGVFGALWPALGAHAYLGDAFFGLGTGYRPGDAWVAFPYLGYRFRLGEGVEAQLRLQTPFRVSAERGLEDFFGLVPNLLDLTLGFPL GT:EXON 1|1-268:0| SEG 6->24|alflllglaqaqgffglga| SEG 66->84|pllgalglgfpgayylglg| SEG 96->109|gllgleaflgegfa| SEG 174->189|alwlggwgfgvfgalw| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHccccEEEEEEcccEEEccccccccEEEEEcccccccccEEEEEEccccHHHHHHHHHcccccEEEEEEccccccccccccccEEHHHHHcccEEEEEEccccEEEEcccEEEEEEEEccccHHHcccccccccEEEEEEEccccccEEEEEEEccccEEEEEcccHHHHHHHHHHHHccHHHHHHHHHHccccccccccEEEcccccEEEEEcccccEEEEEcccEEEcHHccHHHHHHHHHHHHHHHccccc //