[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81737.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.50.3
:79 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->71 1whzA PDBj 1e-08 42.9 %
:RPS:PDB   7->64 2e54A PDBj 5e-04 18.4 %
:RPS:SCOP  7->72 1whzA  d.50.3.2 * 1e-18 40.0 %
:HMM:SCOP  4->74 1whzA_ d.50.3.2 * 1.5e-16 48.6 %
:RPS:PFM   10->65 PF07927 * YcfA 2e-07 52.7 %
:HMM:PFM   11->65 PF07927 * YcfA 8.5e-23 50.9 55/58  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81737.1 GT:GENE AAS81737.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1321806..1322045 GB:FROM 1321806 GB:TO 1322045 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS81737.1 GB:DB_XREF GI:46197323 LENGTH 79 SQ:AASEQ MSPRLIPITGQELVRLLQEEGFQVVWVRGSHVRLRHPDGRVTTVPVHPGETLRPGTLLAILKDVGWSKETYEQKRLGSR GT:EXON 1|1-79:0| BL:PDB:NREP 1 BL:PDB:REP 7->71|1whzA|1e-08|42.9|63/67| RP:PDB:NREP 1 RP:PDB:REP 7->64|2e54A|5e-04|18.4|49/385| RP:PFM:NREP 1 RP:PFM:REP 10->65|PF07927|2e-07|52.7|55/57|YcfA| HM:PFM:NREP 1 HM:PFM:REP 11->65|PF07927|8.5e-23|50.9|55/58|YcfA| RP:SCP:NREP 1 RP:SCP:REP 7->72|1whzA|1e-18|40.0|65/70|d.50.3.2| HM:SCP:REP 4->74|1whzA_|1.5e-16|48.6|70/0|d.50.3.2|1/1|YcfA/nrd intein domain| OP:NHOMO 14 OP:NHOMOORG 12 OP:PATTERN -----------------------------------------------1--2-1--------------- --1-------------------------------------------------------------1---------------------------------------------------------------------------------------2---------1-----1-----------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 82.3 SQ:SECSTR ######TccHHHHHHHHHHTTEEcEEETTTEEEEcccTccEEEETTccHHHHHHHHHHHHHHHHTccHHHH######## DISOP:02AL 1-6, 78-79| PSIPRED cccccccccHHHHHHHHHHcccEEEEEEccEEEEEEccccEEEEcccccccccHHHHHHHHHHHcccHHHHHHHHcccc //