[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81747.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81747.1 GT:GENE AAS81747.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1332144..1332518) GB:FROM 1332144 GB:TO 1332518 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81747.1 GB:DB_XREF GI:46197333 LENGTH 124 SQ:AASEQ MTRRGFLALGLVSLAACTPVVRRKGVPYVRQPEGVVEGGRREFFTALPHAGFAEPVRVRTYQGRPLFLVPQGEAMGPYPLAGLYSLYDPARRGQSPGLGGVLRRLAGGFGARRDPFRPPPHHLA GT:EXON 1|1-124:0| TM:NTM 1 TM:REGION 5->21| SEG 97->113|glggvlrrlaggfgarr| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 118-124| PSIPRED ccHHHHHHHHHHHHHHHcccHHHcccccccccccccccHHHHHHHHccccccccEEEEEEEcccEEEEEEcccccccEEHHHEEEHHcHHHccccccHHHHHHHHHHHcccccccccccccccc //