[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81751.1
DDBJ      :             acetyl-coenzyme A carboxylase carboxyl transferase subunit beta
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  739/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:285 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->258 2f9yB PDBj 2e-58 49.4 %
:RPS:PDB   7->54 3cw2M PDBj 2e-08 20.8 %
:RPS:PDB   36->260 3buzA PDBj 1e-37 7.5 %
:RPS:SCOP  22->258 2f9yB1  c.14.1.4 * 3e-58 51.5 %
:HMM:SCOP  22->283 2f9yB1 c.14.1.4 * 2.3e-77 37.0 %
:RPS:PFM   53->239 PF01039 * Carboxyl_trans 1e-33 47.1 %
:HMM:PFM   101->235 PF01039 * Carboxyl_trans 2e-15 27.8 133/493  
:HMM:PFM   23->52 PF01155 * HypA 0.00074 33.3 27/113  
:BLT:SWISS 19->260 ACCD_METCA 4e-69 54.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81751.1 GT:GENE AAS81751.1 GT:PRODUCT acetyl-coenzyme A carboxylase carboxyl transferase subunit beta GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1335802..1336659) GB:FROM 1335802 GB:TO 1336659 GB:DIRECTION - GB:PRODUCT acetyl-coenzyme A carboxylase carboxyl transferase subunit beta GB:PROTEIN_ID AAS81751.1 GB:DB_XREF GI:46197337 LENGTH 285 SQ:AASEQ MALERLFRRKRPSGGNRDVPELWTKCEACGAQIYKKEFQENLHVCPKCGHHHRLPAQERVAMLADPGTFQETTRLRPLDPLGFVDTKPYVERLKAYQAETGRPDAILGGTCQIGGVPAVLLVMDYAFAGGSMGSVVGEEIARGAERAAEEGRALVIVAASGGARMQEAALSLMQMAKTVMSLDRVWARRLPYVSVLTDPTTGGVTASFAALADVILAEPGALIGFAGPRVIRQTIRQELPEGFQRSEFLLKHGMVDRVTDRRRLKEELVRVLRHLHPGVAYAPGV GT:EXON 1|1-285:0| BL:SWS:NREP 1 BL:SWS:REP 19->260|ACCD_METCA|4e-69|54.1|242/324| SEG 137->153|geeiargaeraaeegra| SEG 261->275|rrrlkeelvrvlrhl| BL:PDB:NREP 1 BL:PDB:REP 22->258|2f9yB|2e-58|49.4|231/257| RP:PDB:NREP 2 RP:PDB:REP 7->54|3cw2M|2e-08|20.8|48/138| RP:PDB:REP 36->260|3buzA|1e-37|7.5|213/413| RP:PFM:NREP 1 RP:PFM:REP 53->239|PF01039|1e-33|47.1|172/454|Carboxyl_trans| HM:PFM:NREP 2 HM:PFM:REP 101->235|PF01039|2e-15|27.8|133/493|Carboxyl_trans| HM:PFM:REP 23->52|PF01155|0.00074|33.3|27/113|HypA| GO:PFM:NREP 1 GO:PFM GO:0016874|"GO:ligase activity"|PF01039|IPR000022| RP:SCP:NREP 1 RP:SCP:REP 22->258|2f9yB1|3e-58|51.5|231/257|c.14.1.4| HM:SCP:REP 22->283|2f9yB1|2.3e-77|37.0|262/0|c.14.1.4|1/1|ClpP/crotonase| OP:NHOMO 798 OP:NHOMOORG 751 OP:PATTERN ------------------------1--1---------------------------------------- 112-1-12111-1---111-11--1211111111111322-112---1-111-11-----111--121-----------111311111--------1--111111111111111111111111112122221221213334---1211111111111111111111111111111111111111112211-111111111111111111111111111111311111111121111111111111111111111-111111-1-22111111111111111111111111111111111111111111111111111111111--11111111111111111111111----2111111111111------11111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111112-----------------------------111111111111111111111111111111-1111111111111111111111111111111111111111111111----11111121111111111111111111--1111111111111111111111111111111111111--------------------1-11111------11111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112212211111111111111111---------------1-1-------------------------1--11-----11- -----------1--------------------------------------------------------------------------------------------------------------------------------------------------2--------------1-111------1---3--1------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 254 STR:RPRED 89.1 SQ:SECSTR ######cccccHHHHcccTTcHHHHHHHHHHHHHHcccTTcHHHHHHHHHHHHccHHHHHHHHHHHHTHHHHHHHHcGGGTcccHHHHHTcHHHTHHHHHHHHHHHHHHccccccEEEEEEcGGGGTcccccccTTcccccHHHHHHHHHHccEEEEEccccEEEEEEEEEEccccccTTcccccEEEEEcTTcccEEEEETTEEEEEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEcccccTTcHHHHHHHHHHHHTT######################### DISOP:02AL 8-21, 280-285| PSIPRED ccHHHHHccccccccccccHHHHHcccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccccHHHHHccccccccccccHHHHHHHHHHccccccEEEEEEEEEccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHcEEEEEEcccEEEEEcHHHHHHHHccccccccccHHHHHHccEEEEcccHHHHHHHHHHHHHHHcccccccccc //