[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81755.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:186 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  36->184 1wdjA  c.52.1.27 * 2e-20 18.8 %
:HMM:SCOP  12->187 1wdjA_ c.52.1.27 * 2.4e-16 26.7 %
:RPS:PFM   112->153 PF05685 * DUF820 5e-05 45.2 %
:HMM:PFM   53->154 PF05685 * DUF820 1.3e-20 33.3 102/111  
:BLT:SWISS 35->163 E41L3_HUMAN 5e-04 31.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81755.1 GT:GENE AAS81755.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1339313..1339873 GB:FROM 1339313 GB:TO 1339873 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS81755.1 GB:DB_XREF GI:46197341 LENGTH 186 SQ:AASEQ MKTTGFMGPCYAKAMATRYRFGLEEYERLFRGVRDVELLAGEVYRMSPIGPKHAWSVARLNRLFTEALGDRAVVWPQNPIRIPPHSEPQPDLALLRPKSYGEGLPTPEDVLLLVEVAETSLEHDQGLKLSLYAQAGIPEVWVLDLKENRLHVYRTPKAGVYTEHRILLPGEEAEPLAFPGVRIPWS GT:EXON 1|1-186:0| BL:SWS:NREP 1 BL:SWS:REP 35->163|E41L3_HUMAN|5e-04|31.0|116/100| RP:PFM:NREP 1 RP:PFM:REP 112->153|PF05685|5e-05|45.2|42/112|DUF820| HM:PFM:NREP 1 HM:PFM:REP 53->154|PF05685|1.3e-20|33.3|102/111|DUF820| RP:SCP:NREP 1 RP:SCP:REP 36->184|1wdjA|2e-20|18.8|144/186|c.52.1.27| HM:SCP:REP 12->187|1wdjA_|2.4e-16|26.7|172/0|c.52.1.27|1/1|Restriction endonuclease-like| OP:NHOMO 90 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------2-------------------------------4----34855662-1---------1-84461---------------68---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------11-----------------------------------1--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccccccccEEEEEEcccEEccHHHHHHHccccccEEEEccEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEcccEEEccccccccEEEEEccccHHccccccccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEccccEEEEEEEcccccEEEEEEEccccEEccccccccEEEEc //