[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81759.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:92 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->80 PF00487 * FA_desaturase 0.00024 13.2 53/257  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81759.1 GT:GENE AAS81759.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1342928..1343206 GB:FROM 1342928 GB:TO 1343206 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81759.1 GB:DB_XREF GI:46197345 LENGTH 92 SQ:AASEQ MGKKKRQEKLKKKALKEWEARRPKTFRQFLPYLPGIFLRTTLVMTAAVTVIVVLGALGLPWAAHFWFQFAVYLAFYLVFQRFIMGPLAPPKV GT:EXON 1|1-92:0| TM:NTM 2 TM:REGION 33->55| TM:REGION 67->89| SEG 3->22|kkkrqeklkkkalkewearr| HM:PFM:NREP 1 HM:PFM:REP 18->80|PF00487|0.00024|13.2|53/257|FA_desaturase| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18, 91-92| PSIPRED cccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //