[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81760.1
DDBJ      :             iojap protein family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  407/915 : Eukaryota  26/199 : Viruses  0/175   --->[See Alignment]
d.218.1
:113 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->111 2o5aB PDBj 4e-10 32.3 %
:RPS:SCOP  10->111 2id1A1  d.218.1.12 * 2e-20 24.5 %
:RPS:PFM   10->107 PF02410 * DUF143 1e-15 41.8 %
:HMM:PFM   11->107 PF02410 * DUF143 2.6e-31 40.2 97/100  
:BLT:SWISS 11->107 CG030_MOUSE 5e-12 33.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81760.1 GT:GENE AAS81760.1 GT:PRODUCT iojap protein family GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1343264..1343605) GB:FROM 1343264 GB:TO 1343605 GB:DIRECTION - GB:PRODUCT iojap protein family GB:PROTEIN_ID AAS81760.1 GB:DB_XREF GI:46197346 LENGTH 113 SQ:AASEQ MVKTKEAVALIERIKELLAEKKAENVVALDLRRVSETLDYFVVASATSTPHLQALERHLLEKLEEEDLRPRPTAGQSPRWVVLDYGEVVVHLMTPEAREYYDLEGFWADAERL GT:EXON 1|1-113:0| BL:SWS:NREP 1 BL:SWS:REP 11->107|CG030_MOUSE|5e-12|33.0|97/228| SEG 55->68|lerhllekleeedl| BL:PDB:NREP 1 BL:PDB:REP 10->111|2o5aB|4e-10|32.3|99/104| RP:PFM:NREP 1 RP:PFM:REP 10->107|PF02410|1e-15|41.8|98/99|DUF143| HM:PFM:NREP 1 HM:PFM:REP 11->107|PF02410|2.6e-31|40.2|97/100|DUF143| RP:SCP:NREP 1 RP:SCP:REP 10->111|2id1A1|2e-20|24.5|102/120|d.218.1.12| OP:NHOMO 439 OP:NHOMOORG 433 OP:PATTERN -------------------------------------------------------------------- -1-1--------1------------------------------------11-1--1-------1--------------1-1-11111-11-1-1-----11--1-111-11111111111111111111111111111111111-111111111111111111111-1111-1-----1--1-11111111111---------------11111----11111-111111111----------------111---111111---11--11-11111---111111111111111111111--------1-------111---1111------------11------1-1--11111111111-1-111111--121---1-11-111---1------111111111111---------111-111-11111111111-111-1111111---------------1----------------1-------1--------1---------------------------------------------1-1------1-----------1------1111--1-------1-1111--111111-11--------------------1---------111---1-11111-1-111111--111--1111-------------11--1111-11-112111111111111111------111------------------1---1---111111111111---1---1------111-111---1--------111111111111111111-1111111111---------11111111111111111--------1111--11111111--------1---------------------------1111-1-111111 -------------------------------------------------------------------------------------------------------111----------1---11--11-1-141-1111---1-11--1---1-1---1------------------1--------1--------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 87.6 SQ:SECSTR #########HHHHHHHHHHHTTcEEEEEEET###TTcccEEEEEEEccHHHHHHHHHHHHHHHHHTTccccEEEcTTTcEEEEEcccEEEEEEETTccTTTcTTTcccEEc## DISOP:02AL 1-5, 69-74| PSIPRED ccccHHHHHHHHHHHHHHHHcccccEEEEEEcccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHcccEEEEEccccccEEEEEcccEEEEEccHHHHHHHHHHHHHcccccc //